KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3171cHelp
Entry
MAB_3171c         CDS       T00657                                 

Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00900  Terpenoid backbone biosynthesis
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01130  Biosynthesis of antibiotics
Module
mab_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAB_3171c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MAB_3171c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 5965676
NCBI-ProteinID: YP_001703902
UniProt: A0A2C9Y4P0
Position
complement(3218604..3219773)
Genome map
AA seq 389 aa AA seqDB search
MSSEVCRVLLLGSTGSIGTQALEVIAANPERFEVVGLAAGGGNVELLRQQISETGVTNVA
VADERAAVRLDIPVLSGPDAVTELVENTEADVVLNALVGALGLRPTLAALKSGARLALAN
KESLVAGGPLVTKAAAPGQIVPVDSEHSALAQCLRGGTRGEVAQLILTASGGPFRGWTAQ
QLTAVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGVPYRQIGVVVHPQSIV
HSMVTFTDGSTLAQASPPDMKLPIALALGWPDRVPAAASACDFSTASTWEFEPLDAQVFP
AVDLARSAGEAGGCMTAVYNAANETAAAAFLDGRIGFRSIVRTIADVLDVASQWEGTSAE
PATVDDVLDAQRWAGQQAAQFIFAEENRT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcagaggtctgccgcgtccttcttctcggcagtaccgggtccatcggtacccag
gcgcttgaggtcatcgccgccaacccggagcgctttgaagtggtcggtttggctgccggc
ggcgggaacgtagagctgctgcgccagcagatctccgaaaccggggtcaccaatgtcgcg
gtggcagacgagcgcgctgccgtgcggctcgacatccccgtgctgagcggaccggatgcc
gtcaccgagttggtggagaacaccgaggccgatgtggtcctcaacgcgctggtcggcgcc
ctcggcctgcggccgaccctggccgcgctgaagtcgggagcccggttggccttggccaat
aaggaatccctggtggccggtgggccgcttgtcaccaaggccgccgcgcccgggcaaatc
gtgcctgtcgattccgaacactccgcgctggcgcaatgtctgcggggagggacccgtggc
gaggtcgcgcagctgatcttgaccgcgtcgggcgggccgtttcggggttggaccgcgcag
cagctcaccgccgtgacccccgagcaggcgggcgcccaccccacctggtccatgggcccg
atgaacacgctcaactcggcatcgctggtcaataaggggctcgaactcatcgagacgcat
ctgctcttcggcgttccctaccggcagatcggtgtggtggtgcacccgcagtcgatcgtg
cactcgatggtgacgttcaccgatgggtcgacgctggcgcaggccagcccgcccgacatg
aaactgcccatcgcgctcgccctgggctggccggaccgagtaccggcagcagcgtcggcc
tgcgacttcagcaccgcctccacctgggagttcgagccgctggatgcccaggtgtttccc
gccgtcgacctggcccgcagtgccggagaagcggggggatgcatgaccgctgtctacaac
gccgccaatgaaaccgcggccgccgccttcctggacgggcgtatcggattcaggtccatc
gtgcgaacaattgccgatgtgctcgatgtggcaagccaatgggagggaacttccgcagaa
cccgctaccgttgacgatgtactcgacgcgcagcgctgggctggccagcaggctgcgcaa
ttcatcttcgcggaggaaaatcggacctga

DBGET integrated database retrieval system