KEGG   Mycobacteroides abscessus ATCC 19977: MAB_3686cHelp
Entry
MAB_3686c         CDS       T00657                                 

Definition
(RefSeq) Probable isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00020  Citrate cycle (TCA cycle)
mab00480  Glutathione metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01200  Carbon metabolism
mab01210  2-Oxocarboxylic acid metabolism
mab01230  Biosynthesis of amino acids
Module
mab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mab_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAB_3686c
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAB_3686c
Enzymes [BR:mab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MAB_3686c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-GeneID: 5966184
NCBI-ProteinID: YP_001704414
UniProt: A0A0U0WTX4
Position
complement(3739460..3741697)
Genome map
AA seq 745 aa AA seqDB search
MSAQQPTIIYTLTDEAPLLATYSFLPIIRAFAGPAGIDVQTSDISVAARILSEFSEYLPE
DQRVPDNLAELGRLTQLPETNIIKLPNISASVPQLLAAIKELQGKGYKLPEYPGDPKNEE
ETEIKARYTKCLGSAVNPILREGNSDRRAPKAVKEYARKHPHSMGEWSQASRTHVATMKE
GDFYHGEKSLTLDRDRTVKMVLTTKSGDTVVLKPEVKLGKGDIIDSMFMSKKALCDFYEE
QIEDAYKTGVMLSLHVKATMMRVSHPIVFGHAVKIFYKDAFEKHQKLFDELGVNVNNGLS
DLYSKIEALPASQHEEIIRDLHACHEHRPELAMVDSAKGISNFHSPSDVIVDASMPAMIR
AGGKMYGADGKLKDTKAVNPESTFSRIYQEMINFVKTHGQFDPRTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEAGVADIVDIDTGEVLLTQNVEEGDIWRMPVVTDAAIQDWVKLAVTRG
RESGMNVVFWLDTERPHEVELRKKVKEYLQDHDTEGLKIQVVPQVWAMRYTLERLIRGKD
TIAATGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGLYETGAGGSAPKHVSQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNARAKILATTLDAATGKLLENDKSPSRKAGELDNR
GSQFYLALYWAAELAAQTEDVELAELFAPLAKQLVENEDQIVAELAAVQGSPADIGGYYA
PDPEKTNAVMRPSQTFNAALASVEV
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcagcagccgaccatcatctacacgctgacagacgaggcgccgctgctcgcg
acgtactccttcttgccgatcatccgggcattcgccgggccggcgggtatcgacgtccaa
accagtgacatctccgttgccgcacgcatcctctccgagttctccgagtaccttcccgaa
gaccagcgtgttccggacaacctggccgagctgggccgcctgacacagcttccggaaacc
aacatcatcaagctgccgaatatcagtgcgtcggtgccgcagctgctggccgcgatcaag
gaactacagggcaagggctacaagctgcccgagtacccgggggaccccaagaacgaagaa
gaaactgagatcaaggcgcggtacaccaagtgtctcggtagtgcggtgaatcccattctg
cgtgaaggcaactcggaccgtcgcgccccgaaggcggtgaaggagtacgcccgcaagcac
ccgcacagcatgggcgagtggtcgcaggcctcgcgcacgcatgtcgccaccatgaaggag
ggcgatttctaccacggagagaagtcgctgacgctggatcgcgaccgcacggtgaagatg
gtgctgaccaccaagagcggtgacaccgtcgtgctcaagcccgaggtcaagctgggcaag
ggcgacatcatcgacagcatgttcatgagtaagaaggcgctctgcgacttctacgaggag
cagatcgaagacgcctacaagaccggtgtgatgctgtccttgcacgtcaaggcgaccatg
atgcgggtcagccaccccatcgtcttcggccacgcggtcaagatcttctacaaggacgcc
ttcgaaaagcaccagaagctgttcgacgagctgggcgtcaacgtcaacaatggattgtcg
gacctgtacagcaagatcgaggccctgcccgcgtcgcagcacgaggagatcatccgcgac
ctgcacgcctgtcacgagcaccggccggagctggccatggtggactcggccaagggtatt
tcgaacttccactcgcccagcgacgtgatcgtcgacgcctcgatgccggccatgattcgg
gccggcggcaagatgtacggcgccgacggcaagctcaaggacaccaaggccgtcaacccc
gagtcgaccttctcccggatctaccaggagatgatcaacttcgtgaagacccacggccag
ttcgacccgaggaccatgggcaccgttcccaacgtcggtctgatggcgcagaaggccgag
gagtacggcagccacgacaagaccttcgagatcgccgaggccggtgtcgccgacatcgtc
gacatcgacaccggcgaggtactgctgacacagaacgttgaagagggcgatatctggcgc
atgccggtcgtcaccgatgccgctattcaggactgggtcaagctcgccgtcacgcggggg
cgcgagtcggggatgaacgtggtgttctggctggacaccgagcgtccgcacgaggtggaa
ctgcgtaagaaggtcaaggaatacctgcaggatcacgacaccgagggcctcaagattcag
gttgtgcctcaggtgtgggccatgcggtacaccctggagcgactgatccgcggtaaggac
accatcgccgcgaccggcaacatcctgcgcgactacctcaccgacctgttcccgatcctg
gagctgggtaccagtgccaagatgctctccatcgtgccgttgatggccggaggcggactg
tacgagacgggcgccggggggtcggcgcccaagcacgtgagccagctggtcgaggagaac
catctgcggtgggattcgctcggtgagttcctggcactggccgtcagcctcgaagacttg
ggcatcaagaccgggaacgcccgggccaagattctggccaccacgctggatgccgcgacc
ggaaagctgctggagaacgacaagagtccgtcccgcaaggccggcgagctcgacaaccgt
ggcagccagttctatctggcgttgtactgggcggccgagctggccgcgcagaccgaagac
gtggaactggccgagctgttcgcaccgctggccaagcagctggtcgagaacgaggatcag
attgtggccgagcttgccgccgtgcagggcagcccggccgatatcggtggctactacgca
ccggaccccgagaagaccaacgccgtcatgcggccgagccagacgttcaacgccgccctg
gcgtccgtcgaggtctag

DBGET integrated database retrieval system