KEGG   Mycobacteroides abscessus ATCC 19977: MAB_4169Help
Entry
MAB_4169          CDS       T00657                                 

Definition
(RefSeq) Possible lipid carrier protein or keto acyl-COA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mab  Mycobacteroides abscessus ATCC 19977
Pathway
mab00071  Fatty acid degradation
mab00072  Synthesis and degradation of ketone bodies
mab00280  Valine, leucine and isoleucine degradation
mab00310  Lysine degradation
mab00362  Benzoate degradation
mab00380  Tryptophan metabolism
mab00620  Pyruvate metabolism
mab00630  Glyoxylate and dicarboxylate metabolism
mab00640  Propanoate metabolism
mab00650  Butanoate metabolism
mab00900  Terpenoid backbone biosynthesis
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
mab01212  Fatty acid metabolism
mab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAB_4169
   00630 Glyoxylate and dicarboxylate metabolism
    MAB_4169
   00640 Propanoate metabolism
    MAB_4169
   00650 Butanoate metabolism
    MAB_4169
  Lipid metabolism
   00071 Fatty acid degradation
    MAB_4169
   00072 Synthesis and degradation of ketone bodies
    MAB_4169
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAB_4169
   00310 Lysine degradation
    MAB_4169
   00380 Tryptophan metabolism
    MAB_4169
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAB_4169
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAB_4169
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAB_4169
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAB_4169
Exosome [BR:mab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAB_4169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 DUF4191
Motif
Other DBs
NCBI-GeneID: 5966631
NCBI-ProteinID: YP_001704896
UniProt: A0A0S1T7V0
Position
4234821..4236011
Genome map
AA seq 396 aa AA seqDB search
MGASKNLAAVIGTGQTKYVAKRQDVSMNGLVREAIDRAMTDAGVDWDDIDAVVVGKAPDF
FEGVMMPELFMADAIGATGKPMIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQS
ESNAMWALSIPVPFSVPVGAGAGGYFAPHVRAYIQRSKAPLDTGAMVAVKDRLNAAKNPL
AHLHQPDITVEKVMSSPMLWDPIRFDETCPSSDGACAIVVGDEQTADRRIKEGHAVAWVH
ATALRTEPLDYTGRDRVNPQAGRDAAAALWKDAGITSPIDEIDVAEIYVPFSWFEPMWLE
NLGFAAEGEGWKLTQAGETAIGGKIPVNASGGVLSSNPIGASGLIRFAEAAIQVMGKAGD
HQVPGAKKALGHAYGGGSQYYSMWVVGSEKPAGKEQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatcgaagaacctggctgccgtcatcggcactgggcagacaaagtacgtcgcc
aagcggcaagacgtctccatgaatggtcttgtccgcgaggccatcgatcgcgccatgacg
gatgccggtgtcgattgggacgatatcgatgctgtcgtcgtcggcaaggcccccgacttt
ttcgagggcgtcatgatgcccgagctcttcatggcggatgcgatcggtgcgaccggaaaa
ccgatgatccgggtgcacaccgcggggtccgtcggaggatcgacaggcgtagtcgcggcc
agcctcgtgcagtcgggcaagtaccgccgggttctggcactcgcctgggagaagcagtcc
gagtcgaatgccatgtgggcgttgtcgattcccgtgccgttctcggttccggtgggagcg
ggcgcgggcggatacttcgcaccccatgtgcgtgcatacatccagcggtccaaagcgccg
ctggacaccggcgccatggtggccgtgaaggaccggctcaacgccgccaagaacccgctg
gcacatctgcatcagcccgatatcaccgtcgagaaggtgatgtcctcccccatgctgtgg
gatcccatccgtttcgatgagacctgcccatcctcggacggcgcctgcgcgatcgtcgta
ggcgacgagcaaaccgcggaccggcgtatcaaggaggggcatgcggtcgcctgggtgcat
gccaccgcgttgcgcaccgagccgctcgactacaccggccgcgaccgggtgaacccgcag
gccgggcgcgatgccgcggccgcactgtggaaggacgccggaatcaccagccccatcgac
gagatcgacgtcgcggaaatctacgtgccgttctcctggttcgaaccgatgtggctggag
aatctgggattcgccgccgagggcgaaggctggaagctcacccaggccggcgagaccgcg
atcggcggcaagattccggtcaacgcgtccggcggcgtgctctcctcgaatccgattggc
gcctcgggccttatccgattcgccgaggccgccattcaggtaatgggcaaggccggtgat
catcaggtaccgggcgccaagaaggcactgggccacgcctacggcggcggctcgcagtac
tactcgatgtgggtggtcggatccgaaaagcccgcaggaaaggagcagtaa

DBGET integrated database retrieval system