KEGG   Mycobacteroides abscessus ATCC 19977: MAB_4845Help
Entry
MAB_4845          CDS       T00657                                 

Definition
(RefSeq) Low-affinity inorganic phosphate transporter PitA
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mab  Mycobacteroides abscessus ATCC 19977
Brite
KEGG Orthology (KO) [BR:mab00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MAB_4845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 5967302
NCBI-ProteinID: YP_001705567
Position
4956347..4957477
Genome map
AA seq 376 aa AA seqDB search
MDIPLLVLIVIVTALAFDFTNGFHDTANAMATSIATGALKPKVAVAVAAVLNLVGAFLST
EVAKTISGGLVDDTKITTAVIFGGLTGAIVWNMLTWLLGIPSSSSMALFGGLIGAVWIGS
GANAVHFGAVISKVLIPAFASPVVAALVAAAATYLAYRIVRSANGASVSRGFRVGQTVSA
SMVSLAHGTSDGQKTMGVITLTLIAAGQLHQGSGPPLWVVFSAGTAIAIGTYLGGWRIIQ
TMGHKLVRIEAPQGFSAETTSTVVLLVSSHAGFPLSTTQVCAGSILGAGLGKDRQSVRWS
VAWRMLLAWCFTLPASGIVGGIAARIANTGNTGVLVVAAVLIGTVTAIYLINRRNAVTAA
TVNEVPAESAVPTTVA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggacattccgcttctggtcctgatcgtgatcgtcaccgctttggcattcgacttcacc
aacgggttccatgacaccgccaacgcgatggcgacctcgatcgctaccggggcgctcaaa
cccaaagtggcggtggctgtggcggcggtgctgaacctggtgggcgccttcttatccacg
gaggtcgccaagacgatctccggcggcttggtcgatgacacgaagatcaccacggccgtg
atcttcggcgggctgaccggggcgatcgtgtggaacatgctgacgtggctgctgggaatt
ccctcgtcttcctcgatggcgctgttcggcgggttgatcggggcggtgtggatcggatca
ggtgccaacgcagtgcatttcggtgcggtgatctccaaggtgctgatcccggcattcgct
tcgccggtcgtggccgcgctcgtggccgccgcggccacctatctggcgtaccggatcgtg
cggtctgccaacggggcatcggtatcgcgtggatttcgggtcgggcagaccgtctcggcg
tccatggtgtcactggcccacggcaccagcgacgggcaaaagaccatgggtgtcatcacg
ttgactctgatcgccgccgggcagctgcaccaaggatccgggccgccgctgtgggtggtg
ttcagcgccggtaccgccatcgcgatcggcacctatctcggtggctggcggatcattcag
accatgggccataaactggtcagaatcgaagccccccagggtttctccgctgaaaccacc
tctacggtggtgctgttggtgtcctcgcatgccgggttcccgctctcgaccacgcaggta
tgcgccggcagcatcctgggtgccggactgggcaaggaccgccaatcggtgcgctggtca
gtggcctggcgaatgctgcttgcctggtgcttcaccttgcccgcctcgggaatcgtcggc
ggcatagctgcccgcatcgccaacaccggcaacaccggggttctggtggtggccgccgtg
ctgatcggcaccgtcaccgcgatctatctgatcaaccgccgcaacgcggtgaccgccgcc
acggtcaacgaggtccctgccgaatccgccgtgccgactacggtcgcctga

DBGET integrated database retrieval system