KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_0391Help
Entry
MASS_0391         CDS       T02682                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mabb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MASS_0391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mabb03400]
    MASS_0391
Enzymes [BR:mabb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MASS_0391
DNA repair and recombination proteins [BR:mabb03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MASS_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD-helicase PhoH SH3_13 AAA_28 T2SSE UvrD_C Herpes_Helicase AAA_16 Mg_chelatase NTPase_1 AAA_23 AAA_5 NACHT CbiA DUF3322 AAA_29 SRP54 AAA DUF2075 TrwB_AAD_bind cobW
Motif
Other DBs
NCBI-ProteinID: AGM26993
UniProt: R4U8I0
Position
complement(420386..422044)
Genome map
AA seq 552 aa AA seqDB search
MSLVEAFGEILEPADVHVAQRLTALASETDESVELAIALAVRALRGGSVCVDLRAVAAQV
DMPSLTWPAADGWLAAVRASPLAGEPPVLRLFGDLLYLDRYWREEHQVCTDVQALLAAAH
PRTEVPTYERLFPQGFEEQQAAADIALSQGLTVLTGGPGTGKTTTVARLLALLAEQASAA
DAPPLRIALAAPTGKAAARLQEAVQLEVNKLDAVDRSRLAGLQATTLHRLLGSRPDTSSR
FKHHRGNRLPHDVIVVDETSMVSLTMMARLLEAVRPQARLLLVGDPDQLASVEAGAVLAD
LVEGLGCERVAALRTSHRFGEAIGALAAAVRDGDADRALEVLASGDPHVEWSTDSEGLRD
VLVPQALALRVASLSGDATAALAVLDEHRMLCAHRHGPFGVAHWNRQVERWITEETGEPH
WAPWYAGRPILVTANDYGLRLYNGDTGVTVAGPDGLRAVIGTASFATSRLVEVETMHAMT
IHKSQGSQANEVTVLLPSEDSRLLTRELFYTAVTRAKQRVRVVGSEAEVRAAIQRQAVRA
SGLGRRLRSGQP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggtggaggcgttcggcgagatcctcgaacccgcggatgtgcatgtggcgcag
cggctgacggcgttggcgtccgagaccgatgagtcggtggagctggcaatcgcgctggcg
gtgcgggcactgcgcggcgggtcggtgtgtgtggatttgcgcgcggtggcggctcaggtg
gatatgccgtcgctgacgtggcccgctgccgatggctggctggcggcggtgcgggccagc
cccttggcgggtgagccgccggtgctgcggcttttcggcgacctgctgtacctcgatcgg
tactggcgcgaggaacatcaggtgtgcacagatgtgcaagcgttgctggccgccgcccac
ccgcgcaccgaagtgcccacctatgagcgacttttcccgcagggattcgaagagcagcaa
gccgccgccgacatcgcgctgtcgcagggcctgaccgtgctgacaggcgggccgggcacc
ggcaagaccaccacggtggcgcggctgttggcgctgttggccgagcaggcatcggcggcg
gatgcgccgccgttgcggatcgcgctggcggcaccgacgggcaaggcggcggcccggctg
caggaagcggtgcagctggaggtcaacaagctggatgccgtcgaccggtcgcggttggcc
gggttgcaggcgaccacgctgcatcgcctgttgggatcgcgccccgacacgtcgtcccgg
tttaagcatcatcgcggaaaccggttgccgcatgacgtgattgtcgtggatgagacgtcg
atggtgtcactgaccatgatggcgcgactgttggaggcggtgcgtccccaggcccgactg
ctgttggtgggcgatccggaccagctggcctccgtggaggcgggcgcggtgctggccgat
ctggtcgaaggtctcgggtgtgaacgcgtcgcggcattgcgcacttcgcaccggttcggc
gaggcgattggtgctcttgcggccgcggtgcgcgatggtgacgccgatcgcgcgctagag
gtgctggcctctggggatccgcatgtggagtggtcgacggattcagaggggctacgcgat
gtgcttgtcccccaggcacttgcattgcgtgtggcgagcctgtccggtgatgccacggcg
gcgcttgccgtgctcgacgagcaccggatgctatgtgcgcatcgccacgggccgttcggc
gtggcgcactggaaccgccaggtggagcggtggatcaccgaggagacgggcgagccgcac
tgggcgccctggtatgcgggaagaccgatcctggtcaccgccaatgactatggcttgcgt
ctgtacaacggtgacaccggtgtgacggtggccggacctgacggactgcgtgcggtgatc
ggcacggcgtcgtttgcgaccagccgtctggttgaggtggagaccatgcacgccatgacc
attcacaagtcacaaggcagccaggcgaatgaagtgactgtgctgctgccgtctgaggat
tcccggctgctgacacgcgagctgttctacacggcggtcacgcgcgccaagcagcgcgtg
cgggtggtgggctcggaggccgaggtgcgggccgcgatccaacggcaggcggtgcgggcg
tcggggctggggcggagattgcggtccggtcaaccgtga

DBGET integrated database retrieval system