KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_1455Help
Entry
MASS_1455         CDS       T02682                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00071  Fatty acid degradation
mabb00072  Synthesis and degradation of ketone bodies
mabb00280  Valine, leucine and isoleucine degradation
mabb00310  Lysine degradation
mabb00362  Benzoate degradation
mabb00380  Tryptophan metabolism
mabb00620  Pyruvate metabolism
mabb00630  Glyoxylate and dicarboxylate metabolism
mabb00640  Propanoate metabolism
mabb00650  Butanoate metabolism
mabb00900  Terpenoid backbone biosynthesis
mabb01100  Metabolic pathways
mabb01110  Biosynthesis of secondary metabolites
mabb01120  Microbial metabolism in diverse environments
mabb01130  Biosynthesis of antibiotics
mabb01200  Carbon metabolism
mabb01212  Fatty acid metabolism
mabb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MASS_1455
   00630 Glyoxylate and dicarboxylate metabolism
    MASS_1455
   00640 Propanoate metabolism
    MASS_1455
   00650 Butanoate metabolism
    MASS_1455
  Lipid metabolism
   00071 Fatty acid degradation
    MASS_1455
   00072 Synthesis and degradation of ketone bodies
    MASS_1455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MASS_1455
   00310 Lysine degradation
    MASS_1455
   00380 Tryptophan metabolism
    MASS_1455
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MASS_1455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASS_1455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MASS_1455
Enzymes [BR:mabb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MASS_1455
Exosome [BR:mabb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MASS_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGM28057
UniProt: R4U8S8
Position
1495022..1496209
Genome map
AA seq 395 aa AA seqDB search
MAATNRSVIVAGARTPVGRFQGSLKDFSGAQLGGIAIAGALAKAGVAPSAVDYVIMGQVL
TAGAGQMPARQAAVAGGIGMDVPALTINKVCLSGVDAIALADQLIRAGEFEVVVAGGQES
MTNAPHLLPKSRAGFKYGDVTLIDHMAFDGLHDAFTDQAMGLLTEQRNVSDKFTREEQDE
FAARSHQNAARGWKDGAFADEVVPVQIPQRKGDPIEFAEDEGIRADTTAASLAGLRPAFS
KDGTITAGSSSPISDGACAVVVMSKERAEREGLEWLAEIGAHGVVAGPDSSLQLQPANAI
RKACEREGISPDQLDLVEINEAFALVGLASIKDLGIDPAKVNVNGGAIAIGHPIGMSGAR
ITLHLAQELKRRGGGIGVAALCGGGGQGDALIVRV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacaaataggtccgtaatagttgctggagcacgtacgccggttggccggttc
cagggatccctgaaggacttttccggtgcccagctcggtggcatcgccatcgcgggcgcc
ctggcgaaggcgggcgtggccccgagcgcagtggactacgtgatcatggggcaggtgctc
accgccggtgcggggcagatgcctgcacgtcaggcagcggttgccggtgggatcggcatg
gacgtcccggcgctcaccatcaacaaggtgtgcctttccggtgtggatgccatcgccctt
gctgaccagctgattcgggccggcgagttcgaggtggtggtcgccggcgggcaggaatcc
atgaccaacgcaccccacctgctgcccaagagccgcgccgggttcaagtacggggacgtg
acgcttatcgatcacatggcgttcgacggcctgcatgacgccttcaccgatcaggccatg
ggcttgctgaccgagcagcgcaacgtctccgacaaattcacccgtgaggagcaggacgaa
ttcgcggctcgttcgcatcagaatgcggcccgcggatggaaggacggcgccttcgccgac
gaagtggtcccggtgcagattccgcagcgcaagggcgatccgatcgagttcgccgaggat
gagggcatccgggccgacaccacggctgcctcgctggccggactgcgtccggcgttcagc
aaggacgggaccatcactgccgggtcgtcgtcgccgatctccgatggtgcctgcgccgtc
gtcgtgatgagcaaagagcgcgcggagcgcgaggggctggaatggctcgccgagatcggc
gcgcacggtgttgtcgccggccccgactccagcctgcagctgcagcccgccaacgctatt
cggaaggcatgcgaacgggaagggatttcgccggaccagcttgacctggtggagatcaac
gaggctttcgcgctggtgggcctggcctcgatcaaggacttgggcattgatccggcaaag
gtcaatgtcaacggtggcgcgatcgcgatcggtcaccccatcggaatgtcgggtgcccgg
atcacgctgcatctggcgcaagagctcaagcgccgtggcggcggcatcggcgtggcggcc
ttgtgtggcggcggtggtcagggtgatgccctgatcgtccgggtgtga

DBGET integrated database retrieval system