KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_0685Help
Entry
MMASJCM_0685      CDS       T03694                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00480  Glutathione metabolism
mabl00590  Arachidonic acid metabolism
mabl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MMASJCM_0685
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MMASJCM_0685
Enzymes [BR:mabl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MMASJCM_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAP95461
Position
687166..687663
Genome map
AA seq 165 aa AA seqDB search
MGGMTDLASIPLTALDGSALSLADFGDNAVLVVNVASKCGLTPQYTALEKLASDYADRGL
TVLGVPCNQFMGQEPGTAEEIREFCSTTYGVSFPLLEKADVNGDNRHPLYAELIKTADAE
GAAGDVQWNFEKFLIARDGSVVNRFRPTTVPDAPEVIAAIEKELG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgggaggcatgaccgatctcgcgtccatcccgttgaccgccctggacggctctgcgctg
tcacttgccgatttcggcgataacgccgtcctggtggtcaacgtcgcgtccaagtgcggt
ctcaccccgcagtacacggccctggagaagctggcctccgactacgccgaccgtggtctg
accgtgctcggggttccctgtaaccaattcatggggcaggaaccgggcacggcggaggaa
attcgggagttctgctccactacctatggggtgagtttcccgctgctggagaaggccgat
gtgaacggtgacaatcggcatccgctgtacgcggagctcatcaagaccgccgatgcggag
ggtgccgcgggtgatgtgcagtggaacttcgagaaattcttgattgcgcgggatgggtcg
gtggtcaatagattccggccgacaacggtgccggacgcgcccgaggtgatcgcggccatc
gagaaggagctgggttag

DBGET integrated database retrieval system