KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_0796Help
Entry
MMASJCM_0796      CDS       T03694                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00071  Fatty acid degradation
mabl00072  Synthesis and degradation of ketone bodies
mabl00280  Valine, leucine and isoleucine degradation
mabl00310  Lysine degradation
mabl00362  Benzoate degradation
mabl00380  Tryptophan metabolism
mabl00620  Pyruvate metabolism
mabl00630  Glyoxylate and dicarboxylate metabolism
mabl00640  Propanoate metabolism
mabl00650  Butanoate metabolism
mabl00900  Terpenoid backbone biosynthesis
mabl01100  Metabolic pathways
mabl01110  Biosynthesis of secondary metabolites
mabl01120  Microbial metabolism in diverse environments
mabl01130  Biosynthesis of antibiotics
mabl01200  Carbon metabolism
mabl01212  Fatty acid metabolism
mabl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMASJCM_0796
   00630 Glyoxylate and dicarboxylate metabolism
    MMASJCM_0796
   00640 Propanoate metabolism
    MMASJCM_0796
   00650 Butanoate metabolism
    MMASJCM_0796
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MMASJCM_0796
   00072 Synthesis and degradation of ketone bodies
    MMASJCM_0796
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMASJCM_0796
   00310 Lysine degradation
    MMASJCM_0796
   00380 Tryptophan metabolism
    MMASJCM_0796
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMASJCM_0796
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMASJCM_0796
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MMASJCM_0796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mabl04147]
    MMASJCM_0796
Enzymes [BR:mabl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MMASJCM_0796
Exosome [BR:mabl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMASJCM_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAP95572
Position
789815..791023
Genome map
AA seq 402 aa AA seqDB search
MTEAFIYEAVRTPRGKQRGGALNEIKPLNLVVGLIEEIRHRHPDLDENLISDVVLGVVSP
VGDQGGDIARTAVLAAGLPDTTGGVQLNRFCASGLEAINIGAQKVRSGWDDLVLAGGVES
MSRVPMGSDGGAWASDPATNYDVSFVPQGIGADLIATIEGFTRDDVDAYAARSQERAAAA
WSGGYFAKSVVPVKDQNGLLVLDHDEHMRPGTTAADLGKLKPAFEGLAALGGFDDVARIK
YHYVEKINHVHTGGNSSGIVDGAALVLIGSEEAGKSQGLTPRARIVATATSGSEPLIMLT
GPTPATKKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPL
GATGAMITGTMVDELERRGLKRALITLCVGGGMGVATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcattcatctacgaggccgtccgtacgcctcgcggcaagcagcgtggcggc
gctctcaacgagatcaagccgctgaacctggtggtcggcctcatcgaggagatccggcac
cgtcaccccgacctggacgagaacctgatcagcgatgtcgtgctgggtgtcgtttccccg
gtcggcgaccagggtggcgatatcgcccgcaccgcggtgctggcggccggcctgcccgac
accaccggtggtgtgcagctcaaccgtttctgtgcctcgggcctggaggccatcaacatc
ggcgcacagaaggtgcgttccggctgggacgacctggtgctcgccggtggtgtggagtcg
atgtcgcgcgtgccgatgggcagcgacggcggcgcctgggcctccgacccggccaccaac
tacgacgtgtccttcgttccgcagggcatcggtgccgacctgatcgccaccatcgaaggc
ttcacccgtgacgatgtggacgcctacgccgcccgctcgcaggagcgcgccgcggccgca
tggtccggtggttacttcgccaagtccgttgtgccggtcaaggaccagaacgggctgctc
gttctcgaccacgacgagcacatgcgccccggcaccaccgctgccgacctgggcaagctc
aagcccgcgttcgagggcctggccgcactcggcggtttcgacgacgtggcgcgcatcaag
taccactacgtcgagaagatcaaccacgtccacaccggcggcaacagctcgggcatcgtc
gacggcgccgccctggtgctgatcggctccgaagaggccggcaagtcgcagggcctgacc
ccgcgcgcccgcatcgtggccaccgccacctccggcagcgagccgctcatcatgctgacc
ggccccaccccggccaccaagaaggtgctcgaccgtgccgggctgaccgttgacgacatc
gacctgttcgagctcaacgaggccttcgcctccgtggtcctgaagttccagaaggacctc
aacatcccggacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccgctg
ggcgccaccggcgccatgatcaccggcaccatggtcgacgagttggagcgtcgcggcctc
aagcgtgccctcatcaccctgtgcgtcggcggcggcatgggtgtagccaccattatcgag
cgagtctga

DBGET integrated database retrieval system