KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_1073Help
Entry
MMASJCM_1073      CDS       T03694                                 

Definition
(GenBank) ribulose-5-phosphate 4-epimerase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00051  Fructose and mannose metabolism
mabl01100  Metabolic pathways
mabl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MMASJCM_1073
Enzymes [BR:mabl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MMASJCM_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAP95849
Position
complement(1078994..1079803)
Genome map
AA seq 269 aa AA seqDB search
MASTLHDTKSELMDRAERSMQTHFSDSQWTTRQKVALTCRALFDRGHDSGLAGQITARAE
EPGTFYTQRLGLGFDEITEENLLLVDEDLNVLEGSGMANPANRFHSWIYRARPDVQCIVH
THPFHVAALSMLETPLIVSQMDIAPLYDDCAFLPDWPGVPVGNEEGEIISAALGDKKAIL
LAHHGHVVAGASVEESCSLAVLIERGAKLQLAAMAAGTIAPLPDRLAREAHDWTLTPKRS
TANFAYYARTALAHHPETLTLPTTQGNSQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacccttcacgacaccaaatccgaactgatggatcgtgccgagcgcagcatg
cagacccatttctccgactcgcaatggaccacccgacagaaggtggcgctgacatgccgg
gcgctcttcgaccgcggccacgattctggcctcgccggacaaatcaccgcgcgcgccgag
gaacccggcaccttctacacccagcgactgggcctgggattcgacgagatcaccgaggag
aacctgcttctcgtcgacgaggatctcaacgttctcgaaggctcaggaatggccaacccc
gccaatcgcttccacagctggatctaccgggctcgcccggatgtgcaatgcatcgtgcac
acccatccgttccacgtcgccgcactgtccatgctggagacaccactgatcgtgtcgcag
atggacatcgcgccgctgtacgacgactgcgccttcctgccggactggcccggcgttccc
gtcggcaacgaggagggcgaaatcatctccgccgcactcggagacaagaaagcgatcctg
ctcgcccaccacggtcacgtcgtcgcgggcgcttccgtcgaagagtcctgctcgctggcg
gtgttgatagagaggggcgccaagttgcaactggccgcgatggcggcgggaaccatcgca
ccgctgcccgaccggctggcccgggaggcgcacgactggaccctcacccccaaacgcagc
actgccaacttcgcctactacgcccgcaccgcgctcgcccatcaccccgaaaccctcact
ctgccgacgacacaagggaattcccaatga

DBGET integrated database retrieval system