KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_1138Help
Entry
MMASJCM_1138      CDS       T03694                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00450  Selenocompound metabolism
mabl00970  Aminoacyl-tRNA biosynthesis
mabl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MMASJCM_1138
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMASJCM_1138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mabl01007]
    MMASJCM_1138
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mabl03016]
    MMASJCM_1138
Enzymes [BR:mabl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MMASJCM_1138
Amino acid related enzymes [BR:mabl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MMASJCM_1138
Transfer RNA biogenesis [BR:mabl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MMASJCM_1138
 Prokaryotic type
   Other AARSs
    MMASJCM_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BAP95914
Position
complement(1142025..1143596)
Genome map
AA seq 523 aa AA seqDB search
MPESLDPFYITTAIAYPNGEPHIGHAYEYVATDAVARFKRLDGFDVRYLTGTDEHGLKVA
QTAAAAGIPTAQLARRNSDVFEALQRTLNISFDRFIRTTDPDHYEASKAIWRKMADNGDI
YLDTYSGWYSVRDEAYYTDAETTVAPDGTRTATATGTPVDWTEEHSYFFRLSAYQDKLLA
HYEAHPEFIGPDVRRNEVVSFVSGGLRDLSISRTTFDWGVPVPDNPEHVMYVWVDALTNY
LTGVGYPDTDSELFGRYWPANIHMIGKDIIRFHTVYWPAFLMSAGIALPRRVFAHGFLTN
KGEKMSKSIGNVVDPINLVNTFGLDQVRYFLLREVPFGQDGSYTEEGLIGRINADLANEL
GNLAQRSLSMVAKNLGGIVPEPGEFAPEDTELLAAADTLLEQARTHFEVPAMHLALEAIW
QVLGASNRYFSAQEPWVLAKSFRTDGSAADQERFGTVLYTTLEVVRIVALLVQPVMPESA
AKLLDLLGQADDQRDFAAIGTRLKPGVSLPAPTGVFPKYQVPK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatcattggatccgttctacatcaccaccgccatcgcgtacccgaacggtgaa
ccgcacatcggacacgcatatgagtacgtcgcgaccgacgccgtcgcccgcttcaaacgg
ctggacggcttcgacgtgcgttatctcacgggcaccgatgagcacggtttgaaggtggcg
cagacggccgccgcggccggaatccccaccgcgcagctggcccggcgcaattccgatgtg
ttcgaggcgctacagcgcacactcaacatctccttcgaccggttcatccgcacgaccgac
ccggatcactacgaggcctcgaaggccatctggcgcaagatggccgataacggtgacatc
tatttggacacctactccggctggtactcggtgcgcgacgaggcgtactacaccgacgcg
gagacgaccgtggcccccgacggcacccgcaccgccaccgcgacggggactccggtcgat
tggaccgaggagcattcctatttcttcaggctctcggcgtaccaggacaagctgctggcc
cactacgaggcacatccggagttcatcggccccgatgtgcggcgcaacgaggtggtcagc
ttcgtctccggcgggctgcgcgacctgtccatctcacggaccaccttcgactggggagtg
ccggtccccgacaaccccgaacatgtcatgtacgtgtgggtggacgcgctgaccaactac
ctgacgggggtcggttacccggataccgattcggagctgttcgggcggtactggcccgcc
aacatccacatgatcggcaaggacatcatccggttccacaccgtgtactggcccgccttc
ctgatgtctgccgggatcgcgctgccccgtcgggttttcgcgcacggcttcctgaccaac
aaaggcgagaagatgagcaagtcgatcggcaacgtcgtcgaccccatcaacctcgtcaac
accttcggcctggatcaggtgcgctactttctgctgcgcgaggtgccgttcgggcaggac
ggcagctacaccgaggaaggcctgatcggacggatcaacgccgacctggccaacgagctg
ggcaatctggcgcagcggtcgctgtcgatggtggccaagaacctgggcggaatcgtgccg
gagccgggtgaattcgcccccgaggacaccgaactcctcgccgccgccgacacgctgctg
gagcaggcccggacgcatttcgaggtgcccgccatgcatctggcgctggaagcgatctgg
caggtgctgggggcgagcaatcggtacttctcggcacaggagccctgggtgctggccaag
agcttccggacagacggatccgcggcggatcaagagcgcttcggcaccgtgctgtacacc
acgctggaagtggttcggattgtcgcgctgttggtgcagccggtgatgcccgagtcggca
gccaagctgctggatctgctgggccaggccgacgaccagcgggacttcgcggccatcgga
acacggttgaagcccggcgtgagcctgcccgcgccgaccggtgtgttcccgaaatatcag
gtgcccaagtag

DBGET integrated database retrieval system