KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_1963Help
Entry
MMASJCM_1963      CDS       T03694                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00260  Glycine, serine and threonine metabolism
mabl00630  Glyoxylate and dicarboxylate metabolism
mabl00670  One carbon pool by folate
mabl01100  Metabolic pathways
mabl01110  Biosynthesis of secondary metabolites
mabl01130  Biosynthesis of antibiotics
mabl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMASJCM_1963
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMASJCM_1963
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MMASJCM_1963
Enzymes [BR:mabl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     MMASJCM_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: BAP96739
Position
1949440..1950603
Genome map
AA seq 387 aa AA seqDB search
MKADEAPTGMSRWCEDQVARVNAMTDLLLGPLHDRHAAQGATFAEFGGWNMPVSYAGTVG
EHTATRAAVGLFDVSHLGKALVRGPGAAAFVNTCFTNDLNKVGPGKAQYTLCCTETGGVI
DDLIAYYVSDDEIFLVPNAANTSAVVAALQEQAPEGIAVTNQHRDYAVLAVQGPRSADVL
QRLGLPTDMEYMAYADATLAGLPVRVCRTGYTGEHGYELLPSWDDAGAVFDALLPVITEA
GGQLAGLGARDTLRTEMGYPLHGHELSLDISPVQARAGWAVGWKKDAFWGREALTQEKTD
GPRRTLRGLRATGRGVLRPDLTVLSDGQPIGVTTSGTFSPTLKTGIALALLDTAAQIPDG
ASVVVDVRGREIECEVVKPPFVDVNVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccgatgaggcgccaaccgggatgagccgctggtgcgaagaccaggtagctagg
gtgaacgccatgacggacctcttgctcggaccactgcacgatcgacacgccgctcagggc
gcaaccttcgccgagttcggcggctggaatatgccggtgtcgtacgcgggaacggtgggg
gagcacaccgccacccgcgcggcggtcggtctgttcgacgtgagtcacctcggcaaggcg
ctcgtacgtggaccgggtgcggcagccttcgtcaacacgtgtttcaccaatgatctcaac
aaggttgggcccggcaaggcgcagtacaccttgtgctgcaccgagaccggcggggtgatt
gacgacctcatcgcgtactacgtatccgacgacgagatcttcctggtgcccaacgccgcc
aatacttccgccgtggtcgcggccttgcaggagcaggcgccggaggggatcgccgtcacc
aatcagcatcgcgactacgcggtgcttgcggtgcaggggcccaggtccgcggacgtgctg
caacggctgggtctgccaacggatatggaatacatggcctacgccgacgccacgctcgcc
ggtctgcccgtgcgggtgtgccgcaccggttacaccggcgagcacggttacgagctgttg
ccgtcctgggacgacgcaggcgctgtattcgatgctctgctgcccgtgatcaccgaggca
ggtgggcagctcgccggtctgggagcacgtgacacgctgcgcaccgagatgggctatccg
ttacacgggcatgagctttccctggacatcagccccgtgcaggcacgggccggatgggcg
gtgggctggaagaaggacgcgttctgggggcgcgaggcgctgacgcaggagaagacggat
ggtccacgccgcacgctgcggggcctgcgcgcgaccggccggggggtgctgcgtcccgat
ctcacggtgctctccgatggccagccgatcggtgttaccacctccgggaccttctcaccc
accctgaagaccggaatcgcgctggccctgctggacaccgcggcccagatcccggacggc
gcgagcgtcgtcgtcgatgtgcgtggccgtgagatcgaatgcgaggtcgtcaagccgcca
ttcgtggacgtcaacgtcggataa

DBGET integrated database retrieval system