KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_3163Help
Entry
MMASJCM_3163      CDS       T03694                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00020  Citrate cycle (TCA cycle)
mabl00620  Pyruvate metabolism
mabl01100  Metabolic pathways
mabl01110  Biosynthesis of secondary metabolites
mabl01120  Microbial metabolism in diverse environments
mabl01130  Biosynthesis of antibiotics
mabl01200  Carbon metabolism
Module
mabl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mabl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMASJCM_3163
   00620 Pyruvate metabolism
    MMASJCM_3163
Enzymes [BR:mabl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MMASJCM_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAP97939
Position
complement(3170656..3172140)
Genome map
AA seq 494 aa AA seqDB search
MSKAQVEQTDVALIGSGIMSATLGALLRLVEPDLSITLIERLDAAASESSDPWNNAGTGH
SALCELNYTPQKADGSIDITKAITVNEQFQVSRQFWAYAVENGVLPDVRGFLNPIPHVSY
VHGADKVEFLRKRHEALVGNPLFAKMEFINDDDEFARRLPLMAAGRDFADPVGLNWSQDG
TDVDFGELSKQLVGFGVRSGTSAVFGTEVRNISRESDGGWLLKLVNGRTGEKRKLKAKFV
FVGAGGGALGLLQKAGIPEAKGFGGFPVSGAFLRTNSTDLTDGHKAKVYGFPPLGAPPMS
APHLDTRVINGKEWLLFGPFAGWSPKFLKMGKVTDLPASIKPNNLLSMVGVGLTEFKLAT
FLLSQLALTPDDRIDMLREFAPKAQRADWELITAGQRVQVIRPAKGKGGALEFGTMVLNS
ADGSIAGLLGASPGASTAVPAMLDVMQRCFPDRYSNWMPKLKEMIPSLGISLSDEPSLFG
EVWDWGTRVLGLEQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaagcgcaggtggagcagacagacgttgccctgattgggtcggggatcatgagt
gcgacgctcggcgctctgctgcggttggtcgaaccggacctgtcgatcaccttgatcgag
cgcctggatgcggccgccagtgaaagcagcgacccctggaacaacgcgggaaccggccac
tcggcactgtgcgagctgaactacaccccgcagaaggccgacgggtcgattgacatcacc
aaggccatcaccgtcaacgagcagttccaggtatcgcgccagttctgggcctacgccgtc
gagaacggtgtgctgcccgacgttcgtggtttcctcaatcccatcccgcacgtgagctat
gtgcacggtgccgacaaggtcgagttcctgcgtaagcgccacgaggccctggtgggcaac
ccgcttttcgcgaagatggaattcatcaacgacgacgacgagtttgcgcgtcgtctgcca
ttgatggccgccggacgcgatttcgccgatcctgtgggtttgaactggagccaggacggc
accgacgtagatttcggtgagctgtcaaagcagttggtgggcttcggtgttcgcagcggc
accagcgcagtcttcggcaccgaggttcgtaacatcagccgtgaaagcgacggcggatgg
cttctcaagctggtcaacggacgcaccggcgagaagcgcaagctgaaggcgaagttcgtc
ttcgtcggtgccggcggcggagctctcgggctactgcagaaggccggaatcccggaagcc
aagggcttcggcggattcccggtcagtggtgctttcctgcgtaccaacagcaccgatctg
accgacgggcacaaggccaaggtgtatggcttcccgccactcggtgcgcccccgatgtcg
gcgccgcacttggacactcgcgtgatcaacggcaaggaatggctgctgttcgggccgttc
gccggatggtcgcccaagttcctgaagatgggcaaggtgacagacctgcccgcctcgatc
aagcccaacaacctgctgtcgatggtgggcgtcggactgaccgagttcaagctggccacc
ttcctgctgagccagcttgcgctcactcccgatgaccgcattgacatgctgcgcgaattc
gcccccaaggcacagcgcgccgactgggagttgatcaccgcgggccagcgtgtacaggtc
atcaggccggccaagggcaagggcggggcgctcgagttcggcaccatggtgctcaactcg
gccgatggcagcatcgccggcctgctcggtgcgtcgccgggagcctctaccgcggtgccc
gcgatgctcgatgtgatgcagcgttgtttccccgaccggtactcgaactggatgcccaag
ctcaaggagatgatcccgtcgctcggcatcagcctttccgacgaaccgtcgctgtttggc
gaggtatgggactggggtacacgggttctcggcctggagcagtga

DBGET integrated database retrieval system