KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_3689Help
Entry
MMASJCM_3689      CDS       T03694                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl00270  Cysteine and methionine metabolism
mabl00920  Sulfur metabolism
mabl01100  Metabolic pathways
mabl01110  Biosynthesis of secondary metabolites
mabl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MMASJCM_3689
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MMASJCM_3689
Enzymes [BR:mabl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     MMASJCM_3689
    2.3.1.46  homoserine O-succinyltransferase
     MMASJCM_3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase DUF4884
Motif
Other DBs
NCBI-ProteinID: BAP98465
Structure
PDB: 

Position
3696947..3698101
Genome map
AA seq 384 aa AA seqDB search
MTIEQQLPAPHIALPQGDEIAYVPIGSVTLESGAVIDDVTIAVQSWGELSPRRDNVVFVC
HALTADSHVVGPAGPDHITGGWWEGIIGPGAAIDTDHWCAVATNVLGGCRGTTGPTSLAR
DGKPWGSRFPEVSVRDQVNADIAALAQLGITEVAAVVGGSMGGARALEWAVMHPDSVHAA
LVLAVGARATGDQIGTQSTQIAAIQTDPDWQGGDYHGSGRSPEKGLNLARRIAHLTYRGE
VELDTRFGNDPQVGPDGPEDPWADGRYAVQSYLEHQGDKFVRRFDAGSYVILTESLNRHD
VGRGRGGVEKALRSCPVPVVVGGITSDRLYPLRLQEELADLLPGCTGLRVVESVHGHDAF
LIEFEAVSELVRETLALAKTTQAS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgaacagcagcttccggccccacacatcgccctgccccagggtgatgagatc
gcctatgtaccaataggttcggtcactctggaaagcggtgctgtgatcgacgacgtgacc
atcgcggtgcaaagctggggcgagctctcaccccggcgcgacaacgtggtgttcgtgtgc
cacgcgctcaccgccgattctcatgtggtcggacctgccgggcccgaccacatcaccggc
ggctggtgggaaggaatcatcggcccgggcgcggcgatcgacaccgaccactggtgcgcc
gtggccaccaatgtcctggggggctgccgaggcaccaccggccccacttccctcgcccgc
gacggcaagccctggggttcacgattccccgaggtctcggtgcgcgaccaggtgaacgcc
gacatcgccgcgctcgcccagctgggcatcaccgaggtcgcggccgtcgtcggcggttcg
atgggcggcgcccgcgcgctggaatgggctgtgatgcatccggattcggttcatgcggcg
ctggtgctggcagtgggcgcgcgggccaccggcgaccagatcggcacgcagagtacgcag
atcgccgccatccagactgatccggactggcagggtggcgactaccacggcagcggacgc
agtcccgagaagggactgaatctggcccggcggatcgcgcatctgacctaccgcggcgag
gtcgaattggacacccggttcggcaatgacccgcaggtcggcccggacggccccgaagac
ccatgggcggatggccgatacgcggtgcagagctacctggaacatcagggcgacaagttc
gttcggcgcttcgacgcgggcagctacgtcatcctgaccgagtcgctcaaccgccacgac
gtcggtcggggccgcggcggtgtggagaaggcactacgcagctgcccggtccctgtcgtg
gtcggcggtatcacctccgaccggctctacccgctgcgactgcaggaggaattagcggat
ctgctgcctggttgtaccggcttgcgggtggtcgagtcggtgcacggccatgacgcattc
ctcatcgagttcgaagcggtgagcgagttggtgcgggaaacgctcgcactggccaagaca
acacaggcttcgtaa

DBGET integrated database retrieval system