KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_3832Help
Entry
MMASJCM_3832      CDS       T03694                                 

Definition
(GenBank) LSU ribosomal protein L22p
  KO
K02890  large subunit ribosomal protein L22
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Pathway
mabl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MMASJCM_3832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mabl03011]
    MMASJCM_3832
Ribosome [BR:mabl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MMASJCM_3832
  Bacteria
    MMASJCM_3832
  Archaea
    MMASJCM_3832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: BAP98608
Position
complement(3833887..3834357)
Genome map
AA seq 156 aa AA seqDB search
MTTTTEFPSATAKARFVRVSPTKARRVIDLVRGKSVNDAIDILRWAPQAASEPVAKVIAS
AAANAQNNDGLDPSTLVVSEIFADEGPTAKRIRPRAQGRAFRIRKRTSHITVVVESRPKQ
EKGGKAGASKASSRAARAQGSKAAAAKKTESKGGTS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaccactactaccgaatttccttcggcgacagccaaggcccgcttcgtgcgggtctcg
ccgaccaaggcacgccgggtcatcgacctggtgcgcggcaagtcggtgaatgacgcgatc
gacatcctgcggtgggcgccacaggcggccagcgagccggtggccaaggtcatcgccagc
gctgctgccaacgcgcagaacaacgatggcctggatccctccacccttgtggtgtcggag
atcttcgccgacgaaggcccgaccgctaagcgcatccgtccccgcgcccaggggcgtgcg
ttccggatccgtaagcgcaccagccacatcaccgtggtcgtcgaaagccgtccgaagcag
gagaagggcggcaaggccggagcatccaaggcttcgtcccgcgccgctcgcgcgcagggt
tccaaggccgccgccgccaagaagactgagtcaaagggaggcaccagctag

DBGET integrated database retrieval system