KEGG   Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300: MMASJCM_4098Help
Entry
MMASJCM_4098      CDS       T03694                                 

Definition
(GenBank) mycothiol S-conjugate amidase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
mabl  Mycobacteroides abscessus subsp. massiliense CCUG 48898 = JCM 15300
Brite
KEGG Orthology (KO) [BR:mabl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MMASJCM_4098
Enzymes [BR:mabl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     MMASJCM_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: BAP98874
Position
complement(4075716..4076579)
Genome map
AA seq 287 aa AA seqDB search
MAVHAHPDDESSRGAATLAKYAAEGHEVLVVTATGGERGDILNPAMNRAGVQENLPDVRR
QEMALAAKTLGVEHHWLGFTDSGLQLDPGLLPADGFALVPLAESVARLTTVIEQFRPHVM
VTYNECGGYPHPDHIRCHQMAVAAYEACPDVAKLYYFHEIVRVTPRMVRFAGRAERIVSR
IPRRQSAAAASTDQRLGDVAVPGWVRVSSMLTRRVGSRRATTLVACGDYFCVRDRALRAH
ASQVDPNGPFFLVPWTWRQHLWPTEKFELAHSRVATKAPETDLFAGL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcacgcccaccccgacgacgagtcgagccgtggtgccgcgaccctggccaag
tatgcggccgaggggcacgaggttctcgtggtaacagccaccggcggcgagcgtggggac
attctcaacccggcgatgaaccgggccggcgttcaggagaacctgccggatgtgcgccgt
caggaaatggcactcgccgcgaaaacccttggtgtcgagcaccattggctgggtttcaca
gactccggtctgcagctggatcctggtctgctgccggcggatggtttcgcgcttgtgccg
ctggccgagtccgtggcacgccttacgacggtgatcgagcagtttcggccgcatgtgatg
gtcacctataacgaatgcggcggctatccacaccccgatcacatccgctgtcatcagatg
gccgtcgcggcctatgaggcctgccccgacgtggccaagctctattactttcacgagatt
gtcagggtgacaccgcgcatggtgcggttcgcgggccgggccgaacgaatcgtcagccgt
ataccgcggcgccaatccgccgccgcggcatccacggatcagcggttgggcgacgtggcg
gtgcccggctgggtgcgggtctcgagcatgctgacgcgacgggtaggcagccggcgtgca
acgacgctggttgcgtgcggagactacttctgcgtacgggacagggcattgcgggcacac
gcgtcgcaagtggaccccaacgggccgttcttcctggtgccatggacctggcggcagcac
ctctggcccacggaaaagttcgagctcgcgcacagtcgcgtcgcgaccaaggccccggag
accgatttgttcgccggtctgtag

DBGET integrated database retrieval system