KEGG   Mycobacteroides abscessus subsp. bolletii MC1518: NF82_22240Help
Entry
NF82_22240        CDS       T03499                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mabo  Mycobacteroides abscessus subsp. bolletii MC1518
Pathway
mabo00071  Fatty acid degradation
mabo00072  Synthesis and degradation of ketone bodies
mabo00280  Valine, leucine and isoleucine degradation
mabo00310  Lysine degradation
mabo00362  Benzoate degradation
mabo00380  Tryptophan metabolism
mabo00620  Pyruvate metabolism
mabo00630  Glyoxylate and dicarboxylate metabolism
mabo00640  Propanoate metabolism
mabo00650  Butanoate metabolism
mabo00900  Terpenoid backbone biosynthesis
mabo01100  Metabolic pathways
mabo01110  Biosynthesis of secondary metabolites
mabo01120  Microbial metabolism in diverse environments
mabo01130  Biosynthesis of antibiotics
mabo01200  Carbon metabolism
mabo01212  Fatty acid metabolism
mabo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mabo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NF82_22240
   00630 Glyoxylate and dicarboxylate metabolism
    NF82_22240
   00640 Propanoate metabolism
    NF82_22240
   00650 Butanoate metabolism
    NF82_22240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NF82_22240
   00072 Synthesis and degradation of ketone bodies
    NF82_22240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NF82_22240
   00310 Lysine degradation
    NF82_22240
   00380 Tryptophan metabolism
    NF82_22240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NF82_22240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NF82_22240
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NF82_22240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mabo04147]
    NF82_22240
Enzymes [BR:mabo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NF82_22240
Exosome [BR:mabo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NF82_22240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIV13057
Position
complement(4499915..4501246)
Genome map
AA seq 443 aa AA seqDB search
MATSSARKSDASQGRRRVAVLGGNRIPFARSDGAYANASNQDMLTAAITGASDRFNLKGE
RLGAVIAGAVLKLSRDFNLTRESVLGSPLSPYTQAFDLQQACGTGLQAAIVGADGIALGR
YESVLAGGVDTTSDAPINFGDDLRHTLLAIRRAKDNVTRLKLLGKLPAALGVDIPQNGEP
RTGLSMGEHAAITAKQAGVKRTEQDALAAASHQKMAAAYDRGFFDDLISPFLGLYRDDNL
RPNSSVEKLATLKPVFGVKHGDATMTAGNSTPLTDGASVALLSSEEWAAERNIPVLAYFV
DGETAAVDYVNGPDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFASVVLATLQAWES
ADYCKERLGLDKPLGAIDRSKLNVNGSSLAAGHPFAATGGRIVAQLAKQLAEKKKENGGT
GTYRGLISVCAAGGQGVTAILEA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactagctcggcacgcaagtcagacgcttcgcaaggccgccgccgtgtagctgtt
ctcggtggtaaccgcattcccttcgcacgttcggacggcgcctatgcgaacgcctccaac
caggacatgttgaccgccgccatcaccggcgcatccgatcgcttcaacctcaagggtgaa
cgtctgggtgccgtcatcgccggtgcggtgctcaagctcagccgtgatttcaatctcacc
cgcgaatcggtgctgggcagcccgctgtcgccgtacacacaggcctttgacctgcagcag
gcctgcggcacgggcttgcaggcggcgatcgtgggtgccgacggcatcgcgctcggccgt
tacgagtcggtgctggccggtggcgtggacaccacctctgatgcaccgatcaacttcggg
gatgatcttcgccacaccttgctggcgatccggcgcgcgaaggacaacgtcacccgcctg
aagctgctcggaaagctgcccgccgccctcggcgtcgacatcccgcagaacggtgagccg
cgtaccggcctgtccatgggagagcacgccgccatcaccgccaagcaggcgggcgtcaag
cggaccgagcaggatgccttggcggccgcgagccatcagaagatggccgctgcctacgac
cgcggcttcttcgatgacctgatcagcccgttcctgggtctgtatcgcgatgacaacctg
cgcccgaattccagcgtggagaagctggcgacattgaagccggtgttcggcgtgaagcac
ggcgacgccaccatgaccgccggtaactccaccccactgaccgacggtgcctcggtggcg
ctgctgtccagcgaggagtgggcggccgagcgcaatatcccggtgctggcctacttcgtc
gacggcgagaccgcggcggtggactacgtcaacggtcccgacggactgctgatggccccg
acctacgcggtgccgcgcctgctggcccgcaacggtctgaccctgcaagacttcgacttc
tacgagattcatgaggcgttcgcctccgtggtgctcgcgacgctacaggcctgggagtcg
gcggactactgcaaggagcgcctcggtctggataagccgctgggtgccatcgaccgctcc
aagctcaacgtcaacggttcctcgctggcggccgggcacccattcgcggcgaccggtggc
cgcatcgtggcccagctggccaagcagctcgccgagaagaagaaggagaacggagggacc
ggtacgtaccgcggactcatctcggtgtgtgcggccgggggccagggtgtgaccgccatt
ctggaagcctga

DBGET integrated database retrieval system