KEGG   Methanosarcina acetivorans: MA_0275Help
Entry
MA_0275           CDS       T00080                                 

Gene name
mtrD
Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mac  Methanosarcina acetivorans
Pathway
mac00680  Methane metabolism
mac01100  Metabolic pathways
mac01120  Microbial metabolism in diverse environments
mac01200  Carbon metabolism
Module
mac_M00357  Methanogenesis, acetate => methane
mac_M00567  Methanogenesis, CO2 => methane
mac_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MA_0275 (mtrD)
Enzymes [BR:mac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MA_0275 (mtrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: AAM03728
UniProt: Q8TU00
Position
complement(330358..331107)
Genome map
AA seq 249 aa AA seqDB search
MIDALMANILWLVFIIIGGVLISWSVHFVPVGGAPAAMAQATGIGTGTVQLAAGAGLTGL
VSAGFMMNVTDNLPLILASGAVGAMIMISVTMIVGTWVYVYGVGCVPSSAKVKYDPITKY
RQDLYVSQGTEGHGLPTVSFVSGVIGGLLGGIGGALVYYSLIEVGLTAGLSTGTSSGVTG
HELVGIAAMFAIGIFFVNAVIPSYNIGGTIEGFHDPKWKKWPKAVISSFVATILCAIVAV
IAISQLGGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgctctcatggcaaacatcctgtggttggtattcattataattggtggcgtc
ctgatttcctggagtgtccacttcgtacccgtaggtggcgcacctgccgccatggctcaa
gcaactggtatcggtacaggtaccgtgcagctggcagccggagcaggactgacaggactt
gtaagtgcagggttcatgatgaacgtaaccgataaccttccgctgattctcgcatcgggt
gcagtgggagcaatgattatgatctctgtgaccatgattgtcggaacctgggtctacgtc
tatggtgtgggctgtgtgccttcttcagcaaaagtaaaatacgacccaattacaaaatac
aggcaggacctgtatgtatcccagggtactgaaggacacggacttccaaccgtttctttt
gtcagtggtgttattggcggcttacttggtggaatcggcggagccctcgtatattattct
cttattgaagtgggccttaccgcaggactcagtacaggtacaagctctggtgttacagga
catgaacttgtaggaattgctgcaatgttcgcaataggcatcttcttcgtaaacgctgtg
attccttcctacaacatcggaggtacaattgaagggttccacgacccgaagtggaagaag
tggccaaaagctgtaatttcttcctttgtagcaacgatactctgtgccatcgtggcagta
atcgcaatttcacagcttggaggtatctaa

DBGET integrated database retrieval system