KEGG   Methanosarcina acetivorans: MA_1805Help
Entry
MA_1805           CDS       T00080                                 

Gene name
mtxA
Definition
(GenBank) methyltransferase
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mac  Methanosarcina acetivorans
Pathway
mac00680  Methane metabolism
mac01100  Metabolic pathways
mac01120  Microbial metabolism in diverse environments
mac01200  Carbon metabolism
Module
mac_M00357  Methanogenesis, acetate => methane
mac_M00567  Methanogenesis, CO2 => methane
mac_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MA_1805 (mtxA)
Enzymes [BR:mac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MA_1805 (mtxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: AAM05211
UniProt: Q8TPU9
Position
complement(2219792..2220385)
Genome map
AA seq 197 aa AA seqDB search
MKTIAENWPPVRGDYVTGKPDSRIAVVTLASHLEAFPNAAIWGSSKTENLGVEKIIVNVI
SNSNIRYVLVCGTESRGHLAGHSLLAIHANGIDEKGRIVGSQGAIPFIENISREAVDRFQ
RQVTLLDRIGLNDPEEIRKIVEDYRDKGEVYPEEPVVVCAPKKRQASFAVPSSGDVIISE
ELVMDSMAGIICLAESL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ctgaagaccattgcagagaactggccccctgtaagaggggactatgtcacaggaaaaccg
gattccaggattgcagtcgtaacccttgcaagccacctcgaggctttccccaatgcagct
atctggggaagttcgaagactgaaaacctgggtgtagaaaaaataatcgtgaacgtaatc
tcaaactccaatatccggtatgtgctcgtctgcggaaccgagtcaaggggccatctggca
ggccattctctgcttgcaatccatgcaaacgggattgacgaaaaaggcagaattgtaggg
tcgcagggggctattccctttatagaaaatatctccagagaagcagtagaccgtttccag
cggcaggtaactctcctggacagaatagggttaaatgaccccgaagagatccgaaagatt
gttgaggattacagggataagggcgaagtataccctgaagagccagtggttgtttgcgcc
ccgaaaaaaaggcaggcgtcttttgcggttccttcttcgggggatgtgataatttcagaa
gaactcgtaatggattctatggcaggaattatctgcctggcagaaagcctctga

DBGET integrated database retrieval system