KEGG   Methanosarcina acetivorans: MA_3731Help
Entry
MA_3731           CDS       T00080                                 

Definition
(GenBank) cytidylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
mac  Methanosarcina acetivorans
Pathway
mac00760  Nicotinate and nicotinamide metabolism
mac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MA_3731
Enzymes [BR:mac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MA_3731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like DUF5446
Motif
Other DBs
NCBI-ProteinID: AAM07083
UniProt: Q8TJP9
Position
complement(4607997..4608530)
Genome map
AA seq 177 aa AA seqDB search
MESGMMRAFYIGRFQPYHFGHHAVITRIAEEVDELVIGIGSAQKSHEATDPFTAGERVLM
LYNALENLPVRHYVLPIEDVRYNSIWVHHVASRTPRFDVVYSNNPLVIQLFREAGFCVKE
SPLYVRERYSGTEIRRRMIAGEKWEHLVPKPVAETIKDIDGITRLRNVSASDSNFSL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggaatccgggatgatgcgagctttctatatcggacgttttcagccgtatcatttcggg
caccatgccgtaattacgcggattgccgaagaggtggacgaactggtcataggtatagga
agtgcccagaagagccatgaagccaccgatccgttcacggcaggggaaagggtactgatg
ctctataatgcgcttgagaaccttcccgtccgtcattacgtccttcctatcgaagatgtc
aggtataactctatctgggtccaccacgtcgcatccagaacccctcgttttgacgtggtg
tactcgaacaatcctctcgttatccagcttttccgggaagccgggttctgcgttaaggag
tctcccctttatgtcagggaaaggtactccgggactgaaatcaggagaaggatgattgcc
ggagaaaaatgggagcaccttgttccgaagcccgttgcggaaacaatcaaagatattgac
ggaataacccgtctgaggaatgtttctgcaagcgatagcaacttttctttataa

DBGET integrated database retrieval system