KEGG   Macrococcus sp. IME1552: BHM04_00730Help
Entry
BHM04_00730       CDS       T05070                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00860  Porphyrin and chlorophyll metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BHM04_00730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:macr01007]
    BHM04_00730
Enzymes [BR:macr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BHM04_00730
Amino acid related enzymes [BR:macr01007]
 Aminotransferase (transaminase)
  Class III
   BHM04_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ATD29812
UniProt: A0A290UV67
Position
complement(149367..150665)
Genome map
AA seq 432 aa AA seqDB search
MNFTNSEKIQKRANEAILGGVNSPSRSYKAVGGGAPVVMARGEGAYFYDVDGNRYIDYLA
AYGPIITGHAHPHITEAIKRAAENGVLYGTPTEHEVVFAEMLKEAIPSLEKVRFVNSGTE
AVMTTIRVARAFTKRDKIIKFAGCYHGHSDLVLVAAGSGPSQLGTPDSAGVPKSVAQEVI
TVPFNDIEQFKEAFHHFGDQIAGVLVEPIVGNFGIVEPKEGFLQAVNDIAHEHGALVIYD
EVITAFRFMYGGAQDLLGVKPDLTAFGKVIGGGLPIGAYGGRQDIMEHVAPLGPTYQAGT
MAGNPLSMQAGIALLEVIKQDGVYEELDRLGKILEDGMLALIDKYNIRATINRLMGAMTI
YFTDEKVVNYEQAENTDGEAFAKFFKLILNQGINLAPSKYEAWFITTEHTEQDIQDTLKA
VENAFMSMTVEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaattttacaaattctgaaaaaatacaaaaacgcgcaaatgaagcgatccttggtggg
gttaactctccatcgcgttcatataaagcagttggcggcggtgctccggtagtgatggct
cgtggtgaaggtgcttacttctatgatgttgacggtaatagatatattgattatttagcc
gcatatggaccaatcattacaggacatgcgcatcctcatattactgaagcgattaagcgt
gcagctgaaaatggcgtgttatatggaacgccgactgaacacgaagttgtgtttgctgaa
atgctaaaagaagcaattccttctttagaaaaggtccgtttcgtaaactctggtactgaa
gcagtaatgacaacaatccgagtagcgcgcgcattcacgaagcgtgataagattattaaa
ttcgccggctgttatcatggacactctgatttagtactagttgctgcaggtagtggcccg
tcacaactcggaacgcccgattctgcaggtgtaccaaaaagtgtggcacaagaagttatt
actgttccatttaatgatattgaacaatttaaagaagcattccatcactttggcgatcag
attgctggcgtccttgttgaaccgattgttggtaactttggaatcgttgaacctaaagaa
ggatttttacaagcagtaaatgatatcgcccatgaacatggtgctttagtgatttacgat
gaagtaattaccgcattccgcttcatgtatggtggtgctcaggatcttttaggtgtaaaa
cccgacttaacagcatttggtaaagtcatcggcggaggattaccaatcggtgcgtatggt
ggccgtcaggacattatggagcatgtggcaccactcggaccaacatatcaggcaggtacg
atggcaggtaatccattaagtatgcaggcaggtatcgcgttacttgaagtcattaagcaa
gatggtgtctacgaagaactagatcgtctcggtaaaatattggaggacggtatgttagcg
cttatcgataaatataatattcgtgccacaatcaaccgtttaatgggtgcaatgaccatc
tactttaccgatgaaaaagttgtcaactatgaacaagcagaaaacactgacggtgaagcg
tttgccaagttctttaaattgattctgaaccaaggtattaacttagcaccatcgaaatat
gaagcatggtttatcacaactgaacatactgaacaagatattcaagatacattaaaagct
gtagaaaacgcttttatgtcaatgacggttgaaaaataa

DBGET integrated database retrieval system