KEGG   Macrococcus sp. IME1552: BHM04_00995Help
Entry
BHM04_00995       CDS       T05070                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
macr  Macrococcus sp. IME1552
Brite
KEGG Orthology (KO) [BR:macr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:macr03009]
    BHM04_00995
Enzymes [BR:macr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BHM04_00995
Ribosome biogenesis [BR:macr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BHM04_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ATD29836
UniProt: A0A290UU14
Position
complement(181999..182817)
Genome map
AA seq 272 aa AA seqDB search
MIINITNEWDTLTIEEMLKALHIPKKPMHEFRMSKEITINNEPATLRSKLSEGDQLYLPI
AEEKSAYKSSYRLCEVKYEDEHLAILVKPKGVKTHPNDMAESNTLLNHAIYTLDSDYVEP
VHRLDQETVGLLLVAKNPFIKKILDRMLEEREITRTYRAKVKSHLPLKNQTIDLPIGKDK
FHPNKRRVSQTGDRAVTHIVDSKALGDGIAEVELTLETGRTHQIRVHLAAIGYPVLGDPL
YSDSNLRQLALESYKLEFIHPLTQEKITAILD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattataaatattacaaatgaatgggatactttaacaatcgaagaaatgttaaaagct
ttacacattcctaaaaagccgatgcatgaattcagaatgtcaaaggaaataacaataaat
aatgaacctgctacattaagaagcaaactttctgaaggtgaccagttatacttaccgatt
gcagaagaaaaaagtgcgtataaatcaagttatcgtctttgtgaagtaaaatatgaagat
gaacatttagcaatccttgtaaaacctaaaggtgttaaaacgcatcctaatgatatggca
gaatctaatactctgctcaaccacgccatctacacgttagactcagattacgtagaaccg
gtacaccgtctcgatcaggaaacagtaggattgctacttgttgcaaaaaatcctttcatc
aaaaagatactcgaccgtatgcttgaagaacgagaaatcacacgcacatatcgtgccaaa
gttaaaagtcatcttccacttaagaatcaaacaatcgatctaccaatcggtaaagataag
tttcatccaaataaacgtcgtgtttcacaaacaggtgatcgcgcagtaacacatattgtt
gattcaaaagctttaggcgatggtatcgcagaagttgaattgacattagaaactggtcgt
acacatcaaattcgtgtacatcttgctgcaattggttaccctgttcttggcgatccactg
tacagtgattctaacttgcgacagcttgcgcttgaaagttataagctggaatttatccat
ccacttactcaggaaaagattactgcaatacttgattaa

DBGET integrated database retrieval system