KEGG   Macrococcus sp. IME1552: BHM04_01975Help
Entry
BHM04_01975       CDS       T05070                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00430  Taurine and hypotaurine metabolism
macr00620  Pyruvate metabolism
macr00640  Propanoate metabolism
macr00680  Methane metabolism
macr01100  Metabolic pathways
macr01120  Microbial metabolism in diverse environments
macr01200  Carbon metabolism
Module
macr_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BHM04_01975
   00640 Propanoate metabolism
    BHM04_01975
  09102 Energy metabolism
   00680 Methane metabolism
    BHM04_01975
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BHM04_01975
Enzymes [BR:macr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BHM04_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ATD30009
Position
362375..363574
Genome map
AA seq 399 aa AA seqDB search
MKKIMAINAGSSSLKFQLFEMPSEKVLTKGLVERIGLKNSVFTLTVDGEKRTRTLDIKDH
EEAVDMMLARMIHYGIIKSVDELDGTGHRVVQGGDLFPTSALVNRDVEEKIAKLIELAPL
HNAANLMGIQAFRRMLPDIPHVAVFDTSFHSTMPETAFLYSLPYQYYKAHKVRKYGAHGT
SHKYVAQRAAEMMDRNHEEGLKIISCHIGNGGSITAVKDGKSVDTSMGFTPLAGITMGTR
TGDIDVATIPYLMEKLHKSAEELLNVYNKESGVLGITGISSDMRDIEIAAENNEGRAQLA
LDIYVDRIQKYIGQYAAVMGGVDGILFTAGVGENSDTIRAAVCEKLEFLGVKVDPEKNNG
LRGKEAIISTDDSRVTVMVIPTDEEVMIARDVMEFGDLG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattatggcaatcaatgccggtagctcgtctttaaaattccaattattcgaa
atgccatcagaaaaagtattaactaaaggtttagtagaaagaatcggattgaaaaattca
gtattcacattgacagttgatggtgaaaaacgtacaagaactttagatattaaagaccat
gaagaagcggttgatatgatgttagcacgcatgattcattacggtattattaaaagtgtt
gatgaattagatggaacaggacatcgtgttgttcaaggtggagatttatttccaacttca
gcattagtgaatcgtgacgttgaagaaaaaatcgcaaagttaatcgaacttgcgccacta
cacaatgcagctaacttaatgggtattcaggctttcagaagaatgttaccggatattcca
cacgttgcagtatttgatacttctttccactcaacaatgcctgaaacagcattcttatat
agcttgccataccagtattataaagcacataaagtacgtaaatatggtgcgcatggtaca
agtcataaatatgtagcacaacgtgcagcagaaatgatggatagaaaccatgaagaaggt
ttaaagattatctcttgtcatattggtaatggtggatcaattacagcagtaaaagatggt
aaatctgtagatacttctatgggcttcacaccacttgctggtattacgatgggtacacgt
acaggtgatattgacgttgctaccattccttatttaatggaaaaattgcataaatctgct
gaagaattattgaatgtatataataaagagtcaggtgtattaggtattacaggtatttca
agtgatatgcgtgatattgaaatcgcagctgagaataacgaaggacgcgctcaacttgca
ttggatatctatgtcgatagaattcaaaaatatatcggacaatatgcagcagtaatgggt
ggcgttgatggtatcttatttacagcaggtgtaggtgagaactctgatacaatccgtgca
gcagtatgtgaaaaattagaattcttaggtgttaaagtagaccctgagaaaaataatgga
ttacgtggtaaagaagcaattatctcaacagatgattctcgtgtaactgtaatggttatt
cctacagatgaagaagtaatgatcgctcgtgacgttatggaattcggggatttaggataa

DBGET integrated database retrieval system