KEGG   Macrococcus sp. IME1552: BHM04_03810Help
Entry
BHM04_03810       CDS       T05070                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00020  Citrate cycle (TCA cycle)
macr00310  Lysine degradation
macr00380  Tryptophan metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01130  Biosynthesis of antibiotics
macr01200  Carbon metabolism
Module
macr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
macr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BHM04_03810
  09105 Amino acid metabolism
   00310 Lysine degradation
    BHM04_03810
   00380 Tryptophan metabolism
    BHM04_03810
Enzymes [BR:macr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BHM04_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 RnfC_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ATD30353
UniProt: A0A290UWZ1
Position
710505..711782
Genome map
AA seq 425 aa AA seqDB search
MAEIRVPELAESITEGTISTWFKQVGDTVEKGENIVELETDKVNVEVISEEAGVITEIKA
QEGDTVEVGSVIAIVGEGGATSAPAENKSPEAAPATPEKTEAAVNSAETSKNASESPEAV
TTNEKSGRIVATPSARKYAREHGIDLASINPRDPKGLIRSHDIQNAVNVPVQAEKAVAPA
QEKPAKPENPAKPVIREKMSRRRKTIANKLLEVSQNTAMLTTFNEIDMTNVMDLRKRKKD
AFQENHDGTRLGFMSFFTKAVVAALKKYPAVNAEIDGDDLILKQFYDIGVAVSTDEGLVV
PVVRDCDKKNFAEIEGSIYDLAIKARDKKLGLDDMMGGSFTITNGGVFGSLMSTPIINGT
QAAILGMHSIVTRPVAIDKERMENRPMMYVALSYDHRIIDGKEAVGFLKTVKELIENPED
LLLES
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaatcagagttccagaattagcagaatctattacagaaggtacgatatcaact
tggtttaaacaagttggagatacagttgaaaaaggcgaaaacatcgttgaacttgaaaca
gataaagttaacgtagaagttatttctgaagaagcaggcgttataacagaaataaaagca
caagaaggagatacagttgaagttggatcagtcatcgcaattgttggtgaaggtggggca
acatcagcaccagcagaaaataaatcacctgaagctgctccagcaactcctgaaaaaaca
gaagcagcagtaaattcagctgaaacttcaaaaaacgcttcagaatcacctgaggctgta
acaacaaatgaaaaaagcggacgtattgtagcaacgccgtctgctagaaagtatgcgcgt
gaacatggtattgatttagcttcaattaatcctcgcgaccctaaaggattaatcagaagt
catgatatacagaatgcagttaatgtacctgttcaagctgaaaaagcagtagctccagca
caggaaaaacctgcaaaacctgagaatcctgcaaaacctgtaattcgtgaaaaaatgagt
cgcagaagaaaaacaattgctaataaattattagaagtttctcagaatactgcaatgctt
actacgtttaacgaaatcgatatgacaaatgttatggatttacgtaaacgtaaaaaagat
gcattccaggaaaatcacgacggtacacgtttaggtttcatgtcattctttacaaaagct
gttgtagcagcacttaaaaaatatcctgctgttaatgctgaaattgatggagacgattta
atcttaaaacaattctatgatatcggtgtagctgtatctactgacgaaggtttagtagta
cctgttgtacgtgattgtgataagaagaactttgctgaaatcgaaggttctatctatgat
ttagcaattaaagcacgcgataaaaaattaggtcttgatgatatgatgggtggttcattt
acaatcactaacggtggtgtattcggttcattaatgtctacacctattatcaatggtacg
caagctgctattttaggtatgcactcaattgtgacgcgtccagttgcaattgataaagaa
cgcatggaaaatcgtccgatgatgtatgtcgcattaagttatgatcacagaattatcgat
ggcaaagaagctgttggtttcttgaaaactgttaaagaattaatcgaaaatcctgaagat
ttattgttagaaagctaa

DBGET integrated database retrieval system