KEGG   Macrococcus sp. IME1552: BHM04_04565Help
Entry
BHM04_04565       CDS       T05070                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00480  Glutathione metabolism
macr00590  Arachidonic acid metabolism
macr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BHM04_04565
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BHM04_04565
Enzymes [BR:macr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BHM04_04565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ATD30491
UniProt: A0A290UW80
Position
862549..863022
Genome map
AA seq 157 aa AA seqDB search
MSIYDINVTNTKHETYPLSQYKGKTMLVVNTASECGFTKQFDGLEKIYQQYKDQDFIVLG
FPCNQFGNQEPGDGAEAEQNCRLNFGVTFPMHDKIEVNGDNAHPLFKYLKQETKGLLGDG
IKWNFTKFLVDKEGNVVNRYAPTKTPESLTEDIEKIL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgatattaatgttacaaatacaaaacatgaaacataccctttatcacaa
tataaaggtaaaacgatgctagttgtcaatactgccagtgaatgcggttttactaaacaa
ttcgatggactggagaaaatttatcaacaatataaggatcaggattttatcgttttaggt
tttccgtgcaatcaatttggtaaccaggaaccaggtgatggcgctgaggctgaacaaaac
tgtcgattaaatttcggcgtaaccttccctatgcatgataaaatagaggtaaatggtgac
aatgcacatccattatttaaatatttaaaacaagaaacaaaaggattacttggtgacggt
atcaaatggaatttcacaaaatttcttgtggataaagaaggaaatgttgttaaccgatac
gcaccaacaaagacacctgaatcattaactgaggatatcgaaaagattctttaa

DBGET integrated database retrieval system