KEGG   Macrococcus sp. IME1552: BHM04_08730Help
Entry
BHM04_08730       CDS       T05070                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00260  Glycine, serine and threonine metabolism
macr01100  Metabolic pathways
macr01110  Biosynthesis of secondary metabolites
macr01120  Microbial metabolism in diverse environments
macr01130  Biosynthesis of antibiotics
macr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BHM04_08730
Enzymes [BR:macr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BHM04_08730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATD31262
UniProt: A0A290UZG0
Position
complement(1694973..1696004)
Genome map
AA seq 343 aa AA seqDB search
MIRFDNDYSTGGHPLILERLVETNDEQHPGYGVDDHCTRAAELIKEQCSGEVDVHFLVGG
TQTNKTVIASMLRPHQAVIAADSGHIAVHETGAIEATGHKVITIPGIDGKLRLEDVENYV
EDYWNDVTFEHIPQPKMVYISQPTEFGTLYSKQELSDLYAFCKQKNMYLMVDGARLGYAL
AAKENDVTIKDISELSDVFYIGGTKVGALFGEAVVFTNDALKPDFRYFIKQNGGMLAKGR
LLGIQYEVLFEDDLYEAISKHAVELADKLTKAFEEKGIQMKYPSPTNQRFPILTKAQIET
LREKYTFADWEKIDDNLFAVRFCTSWSTKCEDVDTLIQDIKAL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgattcgatttgataatgattattcaactggtgggcatccgctaatcctggaacgttta
gtcgaaacaaatgatgagcagcatccgggatatggcgttgatgatcactgcacgcgcgca
gcagaattaataaaagaacaatgtagtggagaagttgatgttcacttcttagtgggtggt
acgcaaacaaacaaaacagtgattgcatcaatgctacgtcctcatcaggcagtcattgca
gctgattctgggcatattgccgttcacgaaacaggtgcaatcgaagcaacgggtcataaa
gtgattacaattccaggtatcgatgggaaattacgattggaagatgtagaaaattatgtt
gaagattattggaatgatgtgacattcgaacatattccgcaaccgaagatggtttatatc
tcgcaaccgacggaatttgggacattatattctaagcaggagttatcggatttatatgct
ttctgtaaacaaaaaaatatgtacttaatggttgatggggcacgtttaggttatgcatta
gcggccaaagaaaatgatgtaacgattaaagatatttctgaactcagtgatgtattctat
atcggtggcactaaagtaggagcactatttggagaagcggtagtatttacaaatgatgca
ttaaaacccgattttagatatttcattaaacaaaacggtggtatgcttgcaaaaggtaga
ttactcggtattcaatatgaggtactttttgaagacgacttgtatgaagcaatttcaaag
catgccgttgaacttgccgataaattgacgaaggcatttgaagaaaagggtatacaaatg
aaatatccatcaccaacaaatcaacgatttccgatattaacgaaagcgcagattgaaaca
cttcgtgagaaatatacatttgctgattgggagaagattgatgacaatttgtttgcagtt
cgtttctgtacaagctggtcaacaaagtgtgaagatgtggatacattaattcaagatatt
aaagcactataa

DBGET integrated database retrieval system