KEGG   Macrococcus sp. IME1552: BHM04_09200Help
Entry
BHM04_09200       CDS       T05070                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
macr  Macrococcus sp. IME1552
Pathway
macr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:macr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BHM04_09200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:macr03011]
    BHM04_09200
Ribosome [BR:macr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BHM04_09200
  Bacteria
    BHM04_09200
  Archaea
    BHM04_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ATD31355
UniProt: A0A290UYC7
Position
complement(1774624..1775001)
Genome map
AA seq 125 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKEVAEAIAILKLTNKASSPVVEKLLMSALANAEH
NYDMNIDTLIVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVGDKEVKTSNEAVT
TEEAK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgcaagaacaatcagaatcgcacctcgtaaagtgagattagtt
ttagatcttatcagaggtaaagaagtagcggaagctattgctattttaaaattaacaaac
aaagcatcatcaccagtagttgaaaagttattaatgtcagcattagcaaatgcggaacat
aactatgatatgaatattgatactttaatcgttaaagaagcttatgcaaacgaaggacca
actttaaaacgtttccgtccacgtgcacaaggtcgtgcaagtgcgattaacaaacgtaca
agccacatcacaatcgttgttggcgacaaagaagttaaaacttcaaacgaagcagtaact
acagaagaagcaaaataa

DBGET integrated database retrieval system