KEGG   Macrococcus sp. IME1552: BHM04_10185Help
Entry
BHM04_10185       CDS       T05070                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
macr  Macrococcus sp. IME1552
Pathway
macr00520  Amino sugar and nucleotide sugar metabolism
macr01100  Metabolic pathways
macr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:macr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BHM04_10185
Enzymes [BR:macr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BHM04_10185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ATD31536
UniProt: A0A290UYR4
Position
complement(1965194..1966336)
Genome map
AA seq 380 aa AA seqDB search
MMRYVIKSKNIFTEEGIVDGYIIINNNKIENVQSGSYSGGDSVYDYQNAYILPGFIDIHI
HGGYGEDAMDASFEGLKHLSKSLLSEGTTSFLPTTMTQSNENIIQALQNIKNVHNDEYEG
SEILGVHLEGPFISEEKIGAQNPKYVQQPNVEQLKTFQEQSGNLIKIITFAPEKEGAKEM
IESFPEIIFSIGHSAATYEQAEQAVANGARHITHLYNGSSGFQHRKPGVVGMALTNDNIH
TELIVDGLHAHPASVKLAITAKGNEKFYLITDAMRAKGKPDGVYDLGGQAVIVKDGEARI
SSGALAGSVLKMNHGLKQLLEYSGKDLSELWRVTSLNQAIALNIDNNKGSIKEEKDADIV
ILDENFEVISTIKSGKRYEF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgttatgtaattaaaagtaaaaatatatttactgaagaaggtatagttgatggt
tatattattattaataataataaaatagaaaatgttcagtctggttcctattcaggagga
gatagtgtatatgattatcagaatgcttatatattacctggatttatagatatacacatt
cacggtggatatggtgaagatgctatggatgcatcatttgagggactaaagcatttatcg
aaatctttgctgagcgagggcacaacatcatttcttcccacaacaatgacacaatcgaat
gaaaatattattcaagcacttcaaaatataaaaaatgtgcacaatgatgaatatgaaggt
tcagaaatattaggagtacatttagaaggtccgtttatttctgaggagaaaattggtgca
caaaatccaaaatacgtgcaacaaccaaatgtagaacaactcaaaacattccaggaacag
tcagggaatttaataaagattattacatttgcacctgaaaaagagggtgcaaaagaaatg
attgaaagtttccctgagattatattctcaattgggcattctgctgcaacttatgaacaa
gcagagcaagcagtagctaacggtgcacgacacattacacatctttataatggcagttca
ggtttccagcaccgcaaacctggtgtagtaggaatggcacttactaatgataatattcat
actgaattaatagtagatggattgcatgcacatccggcaagtgtaaaacttgccataaca
gcaaaaggtaatgagaaattttatttaattacagatgcaatgagagcgaaaggaaaacca
gatggtgtttatgatctaggtgggcaagcagttatcgtgaaagatggagaagccagaata
agttctggcgcacttgcaggtagtgtattaaagatgaatcatggtcttaagcaattatta
gaatatagtgggaaagatttaagtgaactttggcgagtgacaagtctgaatcaggcgatc
gctttaaatatagataataataagggttcaattaaagaggaaaaagatgcggatatcgtt
atactagatgagaattttgaagttatatcgacgatcaagtcaggtaaacgatatgaattt
taa

DBGET integrated database retrieval system