KEGG   Marinobacter adhaerens: HP15_1518Help
Entry
HP15_1518         CDS       T01922                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mad  Marinobacter adhaerens
Pathway
mad00020  Citrate cycle (TCA cycle)
mad00190  Oxidative phosphorylation
mad00650  Butanoate metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01200  Carbon metabolism
Module
mad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mad_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HP15_1518
   00650 Butanoate metabolism
    HP15_1518
  Energy metabolism
   00190 Oxidative phosphorylation
    HP15_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADP97282
UniProt: E4PL74
Position
1597858..1598205
Genome map
AA seq 115 aa AA seqDB search
MGMNSVTNIGRNGIQDWIIQRVSAYVLALYTLFLLGFFISTDVDYQTWSALFDQAWVKIF
TLLALLSIAGHAWVGLWTVTTDYMKSAGQRLLAQAVVILGVFVYVVWGIQIIWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgaacagtgtcacgaatatcggtcgtaacggaattcaggattggatcatccag
cgcgtttcggcctacgtattagccctgtacacgctgtttttactcggctttttcatctcc
accgacgtcgactaccaaacctggtctgctctgttcgatcaggcatgggtgaagatattc
acgcttctggctttgttgtcgattgcggggcatgcatgggtcgggttgtggacagttaca
acggattacatgaaatccgctggacaacggttgctggcccaggcagtggttatcctcggt
gtttttgtgtacgtcgtctggggtattcaaattatttgggggctttaa

DBGET integrated database retrieval system