KEGG   Marinobacter adhaerens: HP15_2094Help
Entry
HP15_2094         CDS       T01922                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mad  Marinobacter adhaerens
Pathway
mad00480  Glutathione metabolism
mad00590  Arachidonic acid metabolism
mad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    HP15_2094
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HP15_2094
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HP15_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADP97858
UniProt: E4PRE9
Position
complement(2193623..2194207)
Genome map
AA seq 194 aa AA seqDB search
MIAVEPALPWFFGLCCEQWSHDEHKHRRESFMAGETVYDFTVRDIKGNEQSMAEYRGKVL
LIVNTASKCGFTPQFEGLQSLHNELGSKGFEVLGFPCNQFLNQDPGDEDAISQFCSLNYG
VDFPMFSKVEVNGDGAHPLFRFLKREAKGLMGSEKVKWNFTKFLVAPDGKVVRRYPPTTK
PEDIRADIEKLLPA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgtagagcctgcattgccatggttttttggtctgtgttgtgaacaatggagt
cacgacgaacacaaacatcgaagggagagcttcatggcaggcgagacggtctacgatttt
acggtaagggatatcaagggtaatgaacaaagcatggcagagtaccggggcaaggtgctc
ctgatcgtgaataccgcgagtaaatgtggtttcacaccgcaattcgaaggcctgcagtcc
ctgcacaacgaattggggagtaaggggtttgaggttctgggttttccctgcaaccagttc
cttaatcaggacccgggcgacgaggatgcaattagccagttctgcagtctcaactacggg
gtcgacttccccatgttttccaaggtcgaagtcaacggtgatggcgcacacccactgttt
cgttttctcaagcgtgaagccaagggactgatggggtcggaaaaggtcaagtggaacttc
accaagttcctggtagctcccgatggcaaggtagtccgtcgctatccgcctacaaccaag
ccggaggatattcgggccgacatcgagaaactgttaccggcctga

DBGET integrated database retrieval system