KEGG   Marinobacter adhaerens: HP15_2423Help
Entry
HP15_2423         CDS       T01922                                 

Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mad  Marinobacter adhaerens
Pathway
mad00071  Fatty acid degradation
mad00072  Synthesis and degradation of ketone bodies
mad00280  Valine, leucine and isoleucine degradation
mad00310  Lysine degradation
mad00362  Benzoate degradation
mad00380  Tryptophan metabolism
mad00620  Pyruvate metabolism
mad00630  Glyoxylate and dicarboxylate metabolism
mad00640  Propanoate metabolism
mad00650  Butanoate metabolism
mad00900  Terpenoid backbone biosynthesis
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01200  Carbon metabolism
mad01212  Fatty acid metabolism
mad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP15_2423
   00630 Glyoxylate and dicarboxylate metabolism
    HP15_2423
   00640 Propanoate metabolism
    HP15_2423
   00650 Butanoate metabolism
    HP15_2423
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HP15_2423
   00072 Synthesis and degradation of ketone bodies
    HP15_2423
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HP15_2423
   00310 Lysine degradation
    HP15_2423
   00380 Tryptophan metabolism
    HP15_2423
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HP15_2423
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP15_2423
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HP15_2423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mad04147]
    HP15_2423
Enzymes [BR:mad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HP15_2423
Exosome [BR:mad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HP15_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF4392
Motif
Other DBs
NCBI-ProteinID: ADP98187
UniProt: E4PH84
Position
complement(2564023..2565162)
Genome map
AA seq 379 aa AA seqDB search
MGGFQGSLASVSATDLGAITIAEAVRRAGLQPADVQEVIMGNVLPAGLKQGPARQAMRKA
GLPDHTGATTINKLCGSGMKAAMFAHDLIKAGSNDIMVAGGMESMSNAPYILQGVRSGYR
MGPGQAPQDHMFLDGLEDAETGRLMGAFAQEMADKKGYTREEMDEYAITSLTRAKKAIEE
GLLKDEIIPVTVKSRKGEVVVEDDEQPHNANIDKIPSLRPAFAKDGTVTAANASSISDGA
SALLLMRESEAEKRGLKPLARIVGHSTQSQHPSEFTCAPVGAIETLFGKTGWSKDDVDLF
EINEAFAMVAMMPIRELGLDPEKVNIHGGACAQGHPVGSTGSRLLVTLMYALQRYGKKKG
IAALCIGGGEATAMAIEML
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggtggattccagggtagcctggccagtgtcagcgcaaccgatcttggagcgatcacc
atcgccgaggccgtaagacgcgctggtctgcagcctgcggacgtgcaggaagtcattatg
ggcaacgtcctgcctgccggcctaaaacagggcccggcgcgccaggccatgcgcaaggcc
ggtcttccggatcacactggggctaccaccatcaataaactctgcggctccggcatgaaa
gccgccatgttcgcccacgatctgatcaaagccggcagcaacgacatcatggttgccggt
ggtatggaaagcatgtccaacgctccctacatcctgcagggtgttcgcagcggctaccgc
atgggcccgggccaggccccccaggatcatatgttcctggacggcctcgaagacgccgaa
accggtcgcctgatgggtgcctttgcccaggaaatggcggacaagaaaggctacacccgg
gaagaaatggatgaatacgccatcacctccctcacgcgagccaagaaagccattgaggaa
ggcctgctgaaagacgagatcattccggtaaccgtgaaaagccgaaaaggcgaggtggtc
gttgaggatgacgagcagccccataacgccaacatcgacaagatcccgagcctccgcccg
gccttcgccaaagatggcaccgtcacagcggcaaacgcctcttcgatctcagacggggct
tctgcgttgctgctgatgcgcgagtccgaggctgaaaaacgcggcctcaaacccctggcc
cgcatcgtcggccacagcacccagtcccagcatccgtccgagttcacctgcgccccggtt
ggcgccatcgaaaccctgttcggcaaaaccggttggagcaaagacgacgtcgatctcttc
gagatcaacgaagccttcgccatggtcgccatgatgccgatccgtgaactcgggctcgac
cccgaaaaagtcaacatccacggcggcgcctgcgcccagggtcaccccgtcggttccacc
ggctcccgcctgctggtcaccctcatgtacgctcttcagcgttacggcaaaaagaagggc
attgcagctctttgcatcggtggcggcgaggctacggccatggctattgagatgctctaa

DBGET integrated database retrieval system