KEGG   Marinobacter adhaerens: HP15_2688Help
Entry
HP15_2688         CDS       T01922                                 

Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
mad  Marinobacter adhaerens
Pathway
mad00250  Alanine, aspartate and glutamate metabolism
mad00330  Arginine and proline metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HP15_2688
   00330 Arginine and proline metabolism
    HP15_2688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mad03000]
    HP15_2688
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HP15_2688
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     HP15_2688
Transcription factors [BR:mad03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    HP15_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH NAD_binding_7 baeRF_family2
Motif
Other DBs
NCBI-ProteinID: ADP98452
UniProt: E4PKH6
Position
complement(2835400..2839029)
Genome map
AA seq 1209 aa AA seqDB search
MRPQQSQTPELVDSRQAIRDYYLADEHKVIHEMIAGAQLSQAERDAISARAAELVRSVRK
NAKSTIMEKFLAEYGLTTKEGVALMCLAEALLRVPDNTTIHELIEDKITSGAWGTHVGKA
SSGLINTATVALLMTSNLLKDSERNTVGETLRKLLKRFGEPVIRTVAGQAMKEMGRQFVL
GRDIDEAQDEAKEYMAKGYTYSYDMLGEAARTDDDAKRYYDSYSNAIDSIAKASKGDVRK
NPGISVKLSALLARYEYGNKERVMNELLPRARELVKKAAAANMGFNIDAEEQDRLDLSLD
VIEELVADPELAGWDGFGVVVQAYGKRSSFVLDWLYGLAEKYDRKFMVRLVKGAYWDAEI
KRAQVMGLNGFPVFTRKACSDVSFLSCATKLLNMTNRIYPQFATHNAHSVSAILEMAKTK
GVDNYEFQRLHGMGESLHNEVLKVSGVPCRIYAPVGPHKDLLAYLVRRLLENGANSSFVN
QIVDKRITPEEIAKDPIVSVEEMGNNISSKAIVHPFKLFGDQRRNSKGWDITDPVTVNEI
EKGRGAYKDYRWKGGPLIAGEVAGTEIQVVRNPADPDDLVGHVTQASDADVDTAITSAAA
AFESWSAKSAEERAACVRKVGDLYEENYAELFALTTREAGKSLLDAVAEIREAVDFSQYY
ANEAIRYKDSGDARGVMCCISPWNFPLAIFTGQILANLAAGNTVVAKPAEQTSLLAIRAV
ELMHQAGIPKDAIQLVPGTGATVGAALTSDSRVSGVCFTGSTATAQRINKVMTENMAPDA
PLVAETGGLNAMIVDSTALPEQVVRDVLASSFQSAGQRCSALRMLYVQRDIADGLLEMLY
GAMEELGIGDPWLLSTDVGPVIDENARKKIVDHCEKFERNGKLLKKMKVPEKGLFVSPAV
LSVSGIEELEEEIFGPVLHVATFEAKNIDKVVDDINAKGYGLTFGIHSRVDRRVERITSR
IKVGNTYVNRNQIGAIVGSQPFGGEGLSGTGPKAGGPQYVRRFLKGETVEREADSNARKV
DAKQLQKLIGQLDKLKASRPEARMDAIRPIFGNVPEPLDAHVEALPGPTGETNRLSNHAR
GVVLCLGPDKETALEQAGTALSQGNKVVVIAPGTQDVVDQANKAGLPIVGAQGLLEPEAL
ATIDGFEAVVSCGDQPLLKAYREALAKRDGALLPLITEHTLDQRFVIERHLCVDTTAAGG
NASLIAASE
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgcagcaatcacagacgcccgagcttgtcgatagccggcaggcgattcgtgat
tattatctcgctgacgagcacaaggttatccacgagatgattgccggtgcccagttgtcc
caggccgagcgcgacgccatttccgctcgtgcggctgaactggtacgcagcgttcgcaag
aatgccaagtccaccatcatggaaaaattcttggcggagtatggcctgacgaccaaggaa
ggcgttgccctgatgtgtctggccgaggcgctgttgcgcgtgcctgacaacaccaccatc
cacgagctgatcgaagacaagatcacctccggtgcctggggcacccacgtgggcaaggcg
tcctctgggctgatcaacaccgccaccgttgccctgctgatgaccagcaacctgctcaag
gattccgagcgcaacaccgtgggtgaaaccctgcgcaagctgctcaagcgcttcggcgag
ccggttatccgtacggtggccggtcaggcgatgaaagagatggggcgacagttcgttctg
ggtcgcgatatcgatgaagcccaggatgaggccaaggaatacatggccaagggttacacc
tattcctacgacatgctgggcgaagctgcccgcaccgatgatgacgccaagcgttactac
gactcctattccaacgccattgacagcattgccaaggcgagcaagggcgatgtccgcaag
aacccgggcatctcggtcaagctctccgccctgctggcccgttacgagtacggcaacaaa
gagcgggtcatgaacgagttgctgccccgggcccgcgaactggtcaaaaaggccgcggct
gcgaatatgggcttcaatatcgatgccgaggagcaggatcgtctggatctgtctctggat
gtgattgaggagctggtggcggatcccgagcttgcaggctgggacggctttggcgtggtt
gttcaggcctatggcaagcgctcctctttcgtactcgactggctctacgggctggccgag
aagtacgaccgcaagttcatggtgcgtctggtgaaaggtgcctactgggatgctgaaatc
aagcgtgcccaggttatgggtctgaacgggttccccgtgtttacccgcaaggcctgcagt
gacgtctcgttcctgtcctgcgccaccaagctgttgaacatgacgaaccggatttaccca
cagttcgccacccacaacgcgcattcggtatctgccattctcgaaatggccaagaccaag
ggtgtggacaactacgaattccagcgcctccacggcatgggcgagtccctgcacaatgag
gttctgaaggtcagtggcgtgccctgtcgcatttatgcgccggttggcccgcacaaggat
cttctggcgtacctggtgcgtcgtttgttggagaacggtgccaacagctccttcgtgaac
cagattgtggacaagcgcatcacaccggaagagatcgccaaggacccgattgtaagtgtt
gaggagatgggcaataacatttccagcaaggcgatcgtgcacccgttcaagctgtttggc
gatcagcgtcgcaactccaaaggctgggatattaccgatccggtcacggttaacgagatc
gagaaaggtcgcggagcctacaaagactatcgctggaaaggtggtccgctgattgcgggc
gaggtggccggtaccgaaatccaggtggtacgtaacccggccgatccggacgatctggtt
ggccacgtcacccaggcctccgatgctgatgtagacaccgcgattacctcagcggcggcc
gcgttcgagagttggtcggccaaatcggctgaagagcgtgctgcctgcgttcgcaaggtg
ggcgacctgtacgaggagaactacgccgagttgttcgcgctcactacccgtgaagcaggc
aaatccctgctggatgcggttgctgagatccgtgaagcggtcgatttctcacagtactac
gccaacgaggccatccgctataaagacagcggcgatgcccgcggcgtgatgtgttgtatt
tcgccctggaacttcccgctggcgatcttcaccgggcagattctggccaacctcgcggca
ggtaacactgtggtggcgaagccggctgagcagacatccctgctggctattcgcgccgtg
gaactgatgcatcaggcgggtatcccgaaggatgccatccagttggtgccgggtaccggc
gcaaccgtgggtgcagccctgacctccgattcgcgggtgagcggcgtgtgctttaccggt
tctaccgctactgcccagcgcattaacaaggtcatgaccgagaacatggcgccggacgcg
ccgctggtggcagagaccggcggcctgaacgcgatgatcgtggactccacggcattgccg
gagcaggttgtccgtgacgtgctggcgtcttcgttccagagtgccggtcagcggtgttcc
gccctgcgtatgctctatgtgcagagagacattgccgatggccttctggaaatgctctac
ggtgcaatggaagagctcggcatcggcgatccctggctgctgtccacggatgtgggcccg
gtgatcgacgagaacgcccgcaagaagatcgtggatcactgcgagaagttcgagcgcaac
ggcaagttgctgaagaaaatgaaagtccccgagaaaggcctgttcgtttcgccggcagtt
ctcagcgtcagtggtattgaggagctggaagaagaaatcttcgggccagtcctgcacgtg
gccacgttcgaggcgaagaacatcgacaaggtggtggacgacatcaacgccaagggctat
ggcctgacgtttggcatccacagccgtgtggatcgccgcgtcgagcgcattaccagccgg
atcaaggtgggtaacacctatgtgaaccgcaaccagatcggtgccatcgtgggctcccag
ccattcggcggtgaaggcctgtctggcaccggtccaaaggccggtggtccgcagtacgtc
cgtcgtttcctgaaaggtgaaacggtcgagcgcgaggcggattcgaacgccaggaaggtg
gatgccaagcagttgcagaagctcatcgggcagctggacaaactgaaggcgtccaggcct
gaagctcgtatggacgcaatccggcccatctttggcaatgttccggagccactggacgct
cacgtggaagcgctacccgggccaacgggtgagaccaaccgcctgtccaaccatgcccgt
ggcgtggtgctgtgtctgggaccggacaaggaaactgctctggagcaggcgggtaccgcg
ttgtcacagggcaacaaggtggtggtgattgcaccgggcacccaggatgtggtcgatcaa
gcgaacaaggccgggctgccgattgttggcgcccagggtctgttggagccggaagcactg
gcaaccatcgatggcttcgaggcggtagtcagctgtggcgatcagcccctgctgaaagcc
tatcgcgaggcactggccaagcgtgatggtgcgttgctaccgctgatcactgagcacacg
ctggatcagcgatttgtgatcgaacgccacctgtgtgtcgacacaacggccgcgggcggt
aacgccagtctgattgccgcctcggaataa

DBGET integrated database retrieval system