KEGG   Marinobacter adhaerens: HP15_2717Help
Entry
HP15_2717         CDS       T01922                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mad  Marinobacter adhaerens
Pathway
mad00071  Fatty acid degradation
mad00280  Valine, leucine and isoleucine degradation
mad00281  Geraniol degradation
mad00310  Lysine degradation
mad00360  Phenylalanine metabolism
mad00362  Benzoate degradation
mad00380  Tryptophan metabolism
mad00410  beta-Alanine metabolism
mad00627  Aminobenzoate degradation
mad00640  Propanoate metabolism
mad00650  Butanoate metabolism
mad00903  Limonene and pinene degradation
mad00930  Caprolactam degradation
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01212  Fatty acid metabolism
Module
mad_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HP15_2717
   00650 Butanoate metabolism
    HP15_2717
  Lipid metabolism
   00071 Fatty acid degradation
    HP15_2717
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HP15_2717
   00310 Lysine degradation
    HP15_2717
   00360 Phenylalanine metabolism
    HP15_2717
   00380 Tryptophan metabolism
    HP15_2717
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HP15_2717
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HP15_2717
   00281 Geraniol degradation
    HP15_2717
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP15_2717
   00627 Aminobenzoate degradation
    HP15_2717
   00930 Caprolactam degradation
    HP15_2717
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HP15_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 HicB_lk_antitox
Motif
Other DBs
NCBI-ProteinID: ADP98481
UniProt: E4PKK5
Position
complement(2870480..2871178)
Genome map
AA seq 232 aa AA seqDB search
MTDLVSYDLKDGVATIAISNGKANALSQEVFEGLNAALDQAEQDKAVVILTGQPGVFSAG
YDLKEMQKGPKEAAALVKTGSTFTRRLAAFPLPIIGACSGHAIAKGAFILLSVDHRIGIE
GPFKLGLNEVAIGMTMHHAGIEIARHRLAPAHFYRSVVNAEIYNPEGAVEAGFLDEVVAQ
DKLVERATELALHFKTLNMRAHRETKVKAKADYLALLDRCIEQDAEHLGLNG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatctggtaagttatgatttgaaagacggtgttgcgacgattgccatcagcaat
ggcaaggccaatgccctgagccaggaagttttcgaggggctcaatgccgcgctggatcag
gcagagcaggataaggccgttgtgatcctgaccggccagccaggcgtgttctctgccgga
tatgacctgaaagaaatgcagaaggggccgaaagaggcagctgcgctggtcaagaccggc
tccacctttacccgccgtctggcggcgttcccgttgccgattatcggtgcctgtagcggt
catgccattgccaagggcgcgtttattctgctgtcagtggatcaccgtattggtattgag
gggcccttcaaactgggcctgaatgaagtggccatcggcatgaccatgcaccatgccggg
attgaaattgcccgccatcggctggcgccggctcacttctaccgttccgtagtgaatgcc
gaaatatacaatccggaaggcgccgtagaggcgggcttcctggatgaggtggttgcccag
gacaagctggttgagcgggctaccgaactggcgctccatttcaaaaccctgaacatgcgc
gcccatcgtgaaaccaaggtgaaggccaaggcggactatctggcgctgctggatcgttgc
atcgagcaggacgccgagcaccttggcctgaatggctag

DBGET integrated database retrieval system