KEGG   Marinobacter adhaerens: HP15_3474Help
Entry
HP15_3474         CDS       T01922                                 

Definition
(GenBank) type VI secretion system, lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mad02044]
    HP15_3474
Secretion system [BR:mad02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HP15_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ADP99238
UniProt: E4PFX4
Position
complement(3662983..3663423)
Genome map
AA seq 146 aa AA seqDB search
MFQHPASDGSQASSGSLFERLEQAAEPAGQSTGDVTRVVESIKRHLVRLLNAHPGNSASV
PDLGLLDFNDATLGTHDLSVQIRGAIRQCIEKFEPRVKRVDVVNLPQGPDPLQLRFQVTV
YLNVGSKDDKTTIDLVLDDKRYYQVV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgttccagcacccggccagcgacggatcgcaggccagcagcggcagcctgttcgagaga
ctcgagcaggctgctgaaccggctggccagagtacgggagacgtgacccgcgttgttgaa
tcgatcaagcgccacctggttcggctgctgaatgcccacccgggcaacagtgccagcgta
ccggatctgggcctgctggacttcaacgacgccacgctcggcacccacgatctgagcgtc
cagattcgtggcgcgatccggcagtgcatcgagaagttcgagcccagggtgaagcgggtg
gatgtcgttaatttgccccagggccctgatccgttacagctgcggtttcaggtgacggtc
tatctgaacgtcggttcgaaagacgacaaaacaaccatagatttggtattggatgacaaa
cgttactaccaggtggtgtaa

DBGET integrated database retrieval system