KEGG   Marinobacter adhaerens: HP15_3475
Entry
HP15_3475         CDS       T01922                                 

Definition
(GenBank) protein containing DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mad02044]
    HP15_3475
Secretion system [BR:mad02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HP15_3475
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ADP99239
UniProt: E4PFX5
Position
complement(3663427..3664908)
AA seq 493 aa
MSDTAVQQSAASESVTEGSLLDQVMANSRMAPADEGYDVARKGVATFIANLLKSDEKGQP
VNKALVDQMVVELDRKISAQMDEILHAPKLQELESSWRGLKLMVDRTDFRENIKVDILHA
TKTELLEDFEFAPDVTQTGFYKHIYSTEYGQFGGEPVGAVVGNYAFTPSTPDMKLLQYVS
SVGAMAHAPFLSSVAPSFFGVDSYQELPAIKELKAVFEGPKYAKWRSLRESEDARYLGLT
SPRFLLRVPYDPTENPVRSFNYKEDVSGDHEHYLWGNTAYLLATRLTESFAKYRWCPNII
GPQSGGAVEDLPVHLFESFGQLEAKIPTEVLITDRREYEMADEGFIALTMRKGSDNAAFF
SANSVQKPKQFPNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKERQDL
ERELNTWIRQYVADQENPPAEVRSRRPLRAAQVTVSDVEGDPGWYQVSLAVRPHFKYMGA
NFELSLVGRLDKD
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtctgatactgctgtgcagcaatctgctgcctccgaatccgtcactgaaggctctctc
ctcgaccaggtcatggccaacagccgcatggcgccggcggatgagggttacgatgtcgct
cgcaagggcgtggcaacatttatagccaatctgctgaaaagcgatgaaaaaggtcagccg
gtgaataaggccctggtggaccagatggtggtggagctggatcgaaagatcagcgcccag
atggatgaaatcctgcacgcgcccaagctgcaggagctggaatcttcctggcgcggcctg
aagctcatggtggaccgcaccgatttccgtgagaacatcaaggtggatatcctccacgcc
accaagaccgagctgctggaagacttcgagttcgcgccggacgttacccagaccggtttc
tacaagcacatctattccacggaatatggccagttcggtggtgaaccggtcggcgcggtt
gttggcaactacgcctttaccccgtccacacccgacatgaagttgctgcagtacgtatcg
tccgtcggagcgatggcccatgctccgtttctgtcctcggtggcaccgtcgttctttggc
gtcgacagctaccaggaactacctgccatcaaggaactgaaggccgttttcgaaggcccg
aaatacgccaagtggcgctccctgcgggaatccgaagatgcccgctacctgggcctgact
tcgccgcgcttcctgctgcgggtgccttacgaccccaccgaaaacccggtgcgcagcttc
aactacaaagaagatgtgtcgggtgaccatgagcactacctgtggggcaataccgcctac
ctgctggccacccgcctgacggaaagcttcgccaagtaccgctggtgcccgaacatcatc
ggtccccaaagcggtggtgcagtcgaggacctgccagtgcacctgttcgaatcctttggt
caactggaagccaagatcccgaccgaagtgctgatcaccgatcgtcgtgaatacgaaatg
gccgacgaaggcttcattgccctgaccatgcgtaaaggcagcgataacgctgcgtttttc
tccgccaactcggtgcagaaacccaagcagttccctaacaccaaggaagggaaggaagcg
gaaaccaactacaaactgggtacccagctgccctacatgatgatcgtgaaccgcctggcc
cactacatcaaggtcctgcagcgggagcagatcggctcctggaaggaacgtcaggatctg
gagcgggagctgaacacctggatacgtcagtacgtggccgaccaggaaaacccgcccgcc
gaagtccgcagccgtcgccccctgcgcgcggcacaggtcaccgtttctgacgtggaaggt
gatccgggctggtaccaggtgtccctggcggttcggccccacttcaagtacatgggtgct
aacttcgaactgtcactggttggccggctggacaaggattaa

DBGET integrated database retrieval system