KEGG   Marinobacter adhaerens: HP15_3476
Entry
HP15_3476         CDS       T01922                                 

Definition
(GenBank) uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
mad  Marinobacter adhaerens
Brite
KEGG Orthology (KO) [BR:mad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mad02044]
    HP15_3476
Secretion system [BR:mad02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   HP15_3476
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADP99240
UniProt: E4PFX6
Position
complement(3664965..3665462)
AA seq 165 aa
MSSKDGSVAPKERINIKYVPATGDQQAETELPLKMFVVGDFKGHAEETPIEDRKAISVDK
NNFRSVMKEAGLTLSTTVTNKLDEEADELPVNLEFQTLDDFSPDSVARQVPELNKLIELR
EALVALKGPLGNVPSFRSKLQELLDNDDARDKLLAELELATDSNE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtcttcaaaagacggttccgtcgcgcctaaagagcgcatcaatatcaagtacgtcccc
gccaccggagatcagcaggcagaaaccgagttgccgctgaagatgttcgtggttggtgat
ttcaagggacacgcagaagaaacccccatcgaagaccgcaaggccatttccgtcgacaag
aacaacttccgttcggtcatgaaggaagccggcctgaccctttccaccaccgtgaccaac
aagctggatgaggaagccgacgaactgccggtaaacctggaattccagacccttgatgac
ttctctcccgacagcgttgcccgtcaggttccggagctgaacaagctgattgaactgcgg
gaagccctggtggccctgaaaggcccattgggtaacgtaccgtcgttccgttccaagctt
caggaactgctggacaacgacgacgcccgggacaagctgctggccgaactggaattggcc
acagacagcaacgagtaa

DBGET integrated database retrieval system