KEGG   Marinobacter adhaerens: HP15_4036Help
Entry
HP15_4036         CDS       T01922                                 

Definition
(GenBank) 4-hydroxy-2-ketovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mad  Marinobacter adhaerens
Pathway
mad00360  Phenylalanine metabolism
mad00362  Benzoate degradation
mad00621  Dioxin degradation
mad00622  Xylene degradation
mad01100  Metabolic pathways
mad01120  Microbial metabolism in diverse environments
mad01220  Degradation of aromatic compounds
Module
mad_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:mad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HP15_4036
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP15_4036
   00622 Xylene degradation
    HP15_4036
   00621 Dioxin degradation
    HP15_4036
Enzymes [BR:mad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     HP15_4036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADP99800
UniProt: E4PLL3
Position
4272488..4273525
Genome map
AA seq 345 aa AA seqDB search
MTFNPGKKLYISDVTLRDGSHAIRHQYSIKNVQDIARALDKAKVDSIEVAHGDGLQGSSF
NYGFGAHTDLEWIEAVAEVIEHAKIATLLLPGIGTVHDLDNAYNAGARIVRVATHCTEAD
VSKQHIEHARKLGMDTVGFLMMSHMQTPKGLAEQAKLMEDYGATCLYVVDSGGAMNMNDI
RDRFRALKDVLKPETQTGMHAHHNLALGVANSIVAVEEGCDRIDASLAGMGAGAGNAPLE
VCIAAFDKMGWEHGTDVYALMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEV
AAQKYGLKAVDILVELGKRRMVGGQEDMIVDVALDLLAAQKEQNA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaaccccggcaaaaaactctacatctccgacgtcaccctgcgcgacggcagc
cacgccatccgccaccagtactccatcaagaacgtgcaggacatcgcacgggcactggac
aaggcgaaggtcgacagtattgaagtggcccacggtgatggccttcagggctcaagcttc
aattacggcttcggcgcccacactgatctggagtggatcgaggcggtggcggaagtgatc
gagcacgccaaaatcgccaccctgctgttgcccggcatcggtaccgtccatgacctggac
aacgcctataacgccggtgcccgcatcgtacgtgtggccactcattgcaccgaagcggat
gtctcgaaacagcacattgaacacgcccgcaagctgggcatggacaccgttggctttctg
atgatgagccacatgcagacaccaaaagggttggcagagcaggccaagctgatggaagac
tacggagccacctgcctgtacgtcgtcgactccggcggagccatgaacatgaacgacatc
cgggaccggttccgggcactcaaggatgtgctcaagccggagacccagacgggcatgcat
gctcatcacaatctcgcgctgggcgtggccaattccattgttgccgttgaggaaggttgt
gaccggattgatgcttccctggccggcatgggtgctggcgccggcaacgcaccgctggaa
gtgtgcattgcggcctttgacaagatgggctgggagcatggcacggacgtgtacgccctg
atggacgcggccgatgacattgtgcgccccttgcaggaccgcccggtgcgggtggaccgc
gaaaccctggccctgggctatgccggtgtctattccagcttcctgcgccactccgaagtg
gcggcgcagaagtacggtctgaaggccgtggatattctggttgagttgggtaagcgccgc
atggttggcggccaggaagacatgatcgtggacgtggcgctggatctgctggcggcccaa
aaggagcaaaacgcatga

DBGET integrated database retrieval system