KEGG   Marinobacter adhaerens: HP15_765Help
Entry
HP15_765          CDS       T01922                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mad  Marinobacter adhaerens
Pathway
mad00260  Glycine, serine and threonine metabolism
mad00750  Vitamin B6 metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01230  Biosynthesis of amino acids
Module
mad_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HP15_765 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HP15_765 (thrC)
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HP15_765 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Plant_vir_prot
Motif
Other DBs
NCBI-ProteinID: ADP96529
UniProt: E4PQI6
Position
774334..775734
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGEAPALGFEDVLLTGLATDGGLYVPESLPHFDLEEIRSWRGLSYSELAFNVMY
PFVDDAIPADDFRKMLDETYSVFAHKAVAPLVQLDTNEWVMELFRGPTLAFKDFALQLLG
RLLDYVLEKRKQHVVIMGATSGDTGSAAIEGCRRCEHVDIFILHPYQRVSEVQRRQMTTV
QGENIHNIAVRGNFDDCQRMVKESFGNQSFLGGKTQLAAVNSINWARIMAQIVYYFHASL
ALGGPDRSMAFSVPTGNFGDIFAGYLAKKMGLPISQLVIATNRNDILHRFMSGNKYEQHQ
LEHTLSPSMDIMVSSNFERLLFDLHGRDGLAVKTLLENAAKGPVSIEDYRWKHARKLFDS
DAVDDKATCDTIREIYEQNEYLLDPHTAIGVRAARNCRRDQAVPMITLGTAHPAKFPDAV
AESGVSVEPPLPAHMADLFEREERYTVLDNNIDGVQAFIAKHWKNA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgagatacatcagtacgcggggtgaagcgcccgcactgggctttgaggatgttctgctg
accggtctggcgacagacggcggcctctatgttcctgaatccctgccacattttgatctg
gaagaaatccggagctggcgcgggctttcgtacagtgagctggcgttcaacgtaatgtac
ccgttcgtggatgacgctatccctgcggatgatttccgcaagatgctggacgagacctac
tcggttttcgcccacaaggccgtggccccactggttcagctggataccaacgagtgggtg
atggagcttttccgcggcccgacgctggcgttcaaggatttcgccctccagctgttaggg
cgtctcctcgactatgttctggagaagcgcaagcagcacgtggttatcatgggagcgacc
tccggtgacaccggctcggctgccattgagggttgtcgccggtgcgagcacgtggatatt
ttcattctgcacccctatcagcgggtgtcagaggttcagcgccgtcagatgaccaccgtc
cagggtgaaaacatccacaacattgcagtgcgtggcaacttcgacgactgtcagcgcatg
gtgaaggagagtttcggcaaccagtcgttcctgggtggcaaaacccagctggcagctgtc
aactccatcaactgggcccggatcatggcccagatcgtctactacttccatgcctccctg
gcactgggcggtccggatcggagcatggcgttttctgtgcccaccgggaacttcggcgat
atctttgccggctaccttgccaagaagatggggctgccaatctcccagctggtcattgcc
accaaccgtaacgatatcctgcatcgcttcatgagtggtaacaaatacgagcagcaccaa
ctggaacacaccctgtctccgagtatggatatcatggtgtccagcaattttgagcgcctg
ctctttgatctccacggccgggacgggctggcggttaaaaccctgctggaaaacgctgcg
aaggggcccgtcagtatcgaggactatcgctggaagcatgcgcgcaagctttttgacagc
gatgcggtggacgacaaggccacctgcgacaccattcgtgagatctacgagcagaacgag
tatctgctggatcctcacaccgccatcggcgtccgtgcagcgcgcaactgccgccgtgat
caggcggtgccaatgattaccctgggtaccgcacacccggccaagttcccggatgccgtg
gcagagtctggcgtcagtgtagagccgccgctgccggcgcatatggccgacctgttcgag
cgggaagagcggtataccgtattggataacaatatcgacggtgtgcaggcattcattgcc
aagcactggaaaaacgcctga

DBGET integrated database retrieval system