KEGG   Methanococcus aeolicus: Maeo_0171Help
Entry
Maeo_0171         CDS       T00552                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae00030  Pentose phosphate pathway
mae00051  Fructose and mannose metabolism
mae00680  Methane metabolism
mae01100  Metabolic pathways
mae01110  Biosynthesis of secondary metabolites
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01200  Carbon metabolism
mae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0171
   00030 Pentose phosphate pathway
    Maeo_0171
   00051 Fructose and mannose metabolism
    Maeo_0171
  Energy metabolism
   00680 Methane metabolism
    Maeo_0171
Enzymes [BR:mae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Maeo_0171
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Maeo_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABR55763
UniProt: A6UTE1
Position
189172..190323
Genome map
AA seq 383 aa AA seqDB search
MNGEKITLSVIKADVGGLCGHTSAPEELMDACEFVLEEALDELIIDYYVTKCGDDVDLIM
THQKGTDNKEIHGLAWSAFEEATEVAKELKLYGAGQDLLSEGFTGNVKGMGPGCAEMEFV
ERPSEPVIVFCSDKTDPAAFNLPFYRMFADPFNTPGLVYDKKMQTGFDFDVLDIYQNKKI
LLNTPKETYQLLALIGNLETYSVKSVYRARDGEIAATCSADKLSKVGGKYVGKDDPVAIV
RPQSGMPSVGEILEAFAKPHMVPGWMRGCHWGPLMPVGEDDANPTRFDGPPRIFALGFQL
SKGRLVGPNDFFADVGFDSARKKALEMADMIREMGPFQPHRLSESMMEYSSIKKVLADLE
DRFVPNEKHEVVDKLTYDVEDQS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagaaaaaataactttaagtgttataaaagctgatgtaggaggattatgtggt
catacctcggcacctgaggaattaatggacgcatgtgaattcgtgcttgaagaagccctt
gatgagttaataattgattactatgtcaccaaatgtggagacgatgtagatttaatcatg
acccaccaaaaaggaacagataataaggaaatacatgggttggcatggagtgcatttgag
gaagccacagaagtggcaaaagaattaaaattatatggtgccggtcaagatttactttcc
gaaggtttcactggaaatgtaaaaggaatgggtccgggctgtgctgaaatggaatttgtt
gaaagaccaagcgaacctgttatagtattttgtagtgataaaacagaccccgcagcgttt
aaccttccattttataggatgtttgcagacccatttaatacgccaggattagtttatgac
aaaaaaatgcaaactggatttgattttgatgtattggacatatatcaaaacaaaaaaata
ttgttaaatactccaaaagaaacatatcaattattggcattaattggaaatttggaaact
tattctgtaaaaagtgtttatagagcaagagatggggaaattgccgcaacatgcagtgca
gataaattaagtaaagttggaggaaaatatgttggtaaagatgaccctgtggcaatagtg
agacctcaaagcggtatgccatcagtaggggaaatattggaagcatttgctaaaccacac
atggttccaggatggatgagaggatgccactggggaccattgatgcctgttggtgaggac
gatgctaacccaacaagatttgatggacctccaagaattttcgcattaggattccagctt
tcaaaaggtagattggtgggaccaaatgatttctttgcagatgttggatttgatagtgca
aggaaaaaagcattagaaatggcagatatgattagagaaatggggccattccagcctcac
agattatctgagtctatgatggaatatagttcaattaaaaaagtattggccgatttagag
gatagatttgtgccaaatgaaaaacatgaagtcgtagataaattaacctatgatgtagaa
gaccaaagttaa

DBGET integrated database retrieval system