KEGG   Methanococcus aeolicus: Maeo_0279Help
Entry
Maeo_0279         CDS       T00552                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mae  Methanococcus aeolicus
Brite
Enzymes [BR:mae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Maeo_0279
Transfer RNA biogenesis [BR:mae03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Maeo_0279
Chromosome and associated proteins [BR:mae03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Maeo_0279
   HAT complexes
    Elongator complex
     Maeo_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ABR55868
UniProt: A6UTP6
Position
complement(303845..305536)
Genome map
AA seq 563 aa AA seqDB search
MNIKNTKSKILNKNTENHNENYEKSYKEFILYIIKKLMENSKDINNLPPKKKKQKIEDIK
ARGLRKYKLNIGFPPNSEIIKYATEEEKKIIVPILRKKPIRTLSGVAVVAIMTSPHECPH
GKCFFCPGGTDSNFGEVPQSYTGKEPATMRGIMYDFDPYIQTKERIEQLEKVGHPTDKVE
IIIMGGTFPSRPPEYQDNFVKGCLDALNGTISDTLEEAQKINETAKHRCVALTVETRPDY
CTEKEINQMLKLGATKVEIGVQTIYNDILNHIKRGHGVEDTIKATQLLRDSGLKISYHIM
PGLPMSSKELDKKLFYEIFNNPNFKPDLIKIYPCLVIKGTELYDIYERGEFKPINDNDAI
ELITYAKSIMPKWVRTSRIQRDIPATVIEEGVRKSNLGELIYKNLEAQNIKCKCIRCREV
GHIIYKKGIIPKLEDIKLCREDYEANGGTEIFLSYEDTKNDILIGYLRLRIPYKPFRPEI
DNNTALIRQLHICGQGQKLTETEDKETTWQHKGYGKLLLKEAEKIAKEEFNKNKILINSG
IGVREYYKKIGYERIGAYMGKNL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaaaatacaaaatcaaagattttgaataaaaatactgaaaatcataatgaa
aactatgaaaaaagctataaagaatttatattatatataattaaaaaactaatggaaaat
agcaaagatataaacaatttacctccaaaaaagaaaaaacaaaagatagaagatataaaa
gctcgaggtttaaggaaatataaattaaatataggatttcctccaaattcagaaataata
aaatatgccacggaggaggagaaaaaaataatagtcccaatattgagaaaaaaacctatt
agaacactttcgggtgtggctgttgtggcaattatgacctcccctcatgagtgcccacat
ggaaaatgttttttctgtccagggggaacagacagcaattttggagaagtaccccaaagc
tacacaggaaaagaaccagccacaatgcgaggaattatgtatgattttgacccatatatt
caaacaaaggaaagaatagaacagcttgaaaaagttggacatccaaccgataaagtagaa
ataattataatgggggggacatttccatctaggccaccagaatatcaggacaactttgtt
aaaggctgtttagatgctttaaatggaacaatatccgatacacttgaagaagcacagaag
ataaacgaaactgcaaaacatagatgcgtggcacttactgtggagactagacctgactac
tgcacagaaaaagaaataaaccaaatgctaaaattgggagctacaaaagtagaaattgga
gttcaaaccatatacaacgacatattaaatcatataaaaagaggacatggtgtagaagat
actataaaagcaacccaattattaagagatagtggtttaaaaatatcttaccatattatg
ccggggcttccaatgtcttcaaaagaattggataaaaaattattctacgaaatatttaac
aatccgaactttaaaccagatttaataaaaatatacccctgtcttgtaataaaaggaact
gaattatatgacatatatgaaagaggagaatttaaaccaataaatgataatgatgcaata
gaattaattacctacgcaaaatcaataatgccaaaatgggttagaacctcacgaatacag
cgagatatacctgcaacggtaattgaggaaggagttcggaaaagtaatttgggggagctc
atatataaaaatttagaggctcaaaatataaaatgtaaatgtataagatgtagggaagtt
ggacatataatatataaaaaaggaataataccaaaattagaagatataaaactttgtagg
gaagactatgaagcaaatggtggaacagagatatttttatcgtatgaagacaccaaaaat
gatatattaataggctaccttagattaagaattccatataaaccatttagaccagagata
gataacaacacggcattaataagacagctccatatatgcggacaggggcaaaaattaacc
gaaacagaggacaaagaaacaacatggcaacataaaggatatggaaaattattattaaaa
gaggctgaaaaaatagcaaaagaagaatttaataaaaataaaatattaataaatagcggt
attggagttagagaatattataaaaagataggttatgaaagaattggggcatatatggga
aaaaatttataa

DBGET integrated database retrieval system