KEGG   Methanococcus aeolicus: Maeo_0311Help
Entry
Maeo_0311         CDS       T00552                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mae  Methanococcus aeolicus
Pathway
mae00300  Lysine biosynthesis
mae00680  Methane metabolism
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01210  2-Oxocarboxylic acid metabolism
mae01230  Biosynthesis of amino acids
Module
mae_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mae00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Maeo_0311
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Maeo_0311
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Maeo_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase PhoH DUF521
Motif
Other DBs
NCBI-ProteinID: ABR55899
UniProt: A6UTS7
Position
336478..337743
Genome map
AA seq 421 aa AA seqDB search
MTLAEEILSKKVGKKVKAGDVVEIDIDLAMTHDGTTPLSAKAFKQITDKVWDNKKIVIVF
DHNVPANTLKAANMQKITREFIKEQNIINHYLDGEGVCHQVLPENGHIQPNMVIAGGDSH
TCTYGAFGAFATGFGATDMGNIYATGKTWLKVPKTIRINVNGENDKITGKDIILKICKEV
GRSGATYMALEYGGEAIKKLSMDERMVLSNMAIEMGGKVGLIEADETTYNYLRNVGISEE
KILELKKNQITIDENNIDNDNYYKIINIDITDMEEQVACPHHPDNVKNISEVKGAPINQV
FIGSCTNGRLNDLRIASKYLKGKKVHNDVRLIVIPASKSIFKQALKEGLIDIFVDAGALI
CTPGCGPCLGAHQGVLGDGEVCLATTNRNFKGRMGNTTAEIYLSSPAIAAKSAIKGYITN
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacattggcagaggaaatattatcaaaaaaagtaggaaaaaaagtaaaagcaggagat
gttgtagaaatagatatagatttagcaatgactcatgatggaacaacaccattatctgca
aaggcatttaaacagataaccgataaggtatgggacaataaaaaaatagtcatagtattt
gaccataatgtcccagcaaatacattaaaagccgcaaatatgcaaaaaattacacgagaa
tttataaaagaacaaaatataataaatcattatttggatggtgaaggcgtatgccatcaa
gtgctacctgaaaacggacatatacaaccaaacatggttatagctggtggagatagtcac
acatgcacctatggggcatttggggcatttgcaacaggatttggggctaccgacatgggg
aatatatatgcaacaggaaaaacttggttaaaagttccaaaaaccataagaataaatgtt
aatggagaaaatgataaaattactggaaaagatattattttaaaaatttgtaaagaagtt
ggacgaagtggagctacttacatggcacttgaatacggcggggaagcaataaaaaaatta
agtatggacgaaagaatggttttaagcaatatggctatcgaaatgggcggaaaagttggg
cttatcgaagccgatgaaaccacatataattaccttagaaatgtaggaattagtgaagaa
aaaatattagaattgaaaaaaaatcaaataaccattgatgagaacaatatagataatgat
aattattataaaattataaatatagatattacagacatggaggagcaagtggcatgccct
caccatcccgataatgttaaaaatatttcggaagtaaaaggagctcccataaatcaggtg
ttcataggttcatgcacaaatggtaggttgaacgatttaagaatagcctcaaaatattta
aaaggaaaaaaggttcataatgatgttagattaatagtaatacctgcttcaaaatcaata
tttaaacaggcattaaaagaaggattaattgatatttttgtagatgctggagctttaatt
tgcacccccggatgcggtccttgtttgggggcccaccaaggagttttaggagatggtgaa
gtttgtttagccaccacaaatagaaatttcaaaggaagaatgggaaatacgacagcggaa
atatatttatcctcccccgctattgccgcaaaaagtgcaattaaaggatatatcacaaat
gaataa

DBGET integrated database retrieval system