KEGG   Methanococcus aeolicus: Maeo_0377Help
Entry
Maeo_0377         CDS       T00552                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mae  Methanococcus aeolicus
Pathway
mae00040  Pentose and glucuronate interconversions
mae00052  Galactose metabolism
mae00500  Starch and sucrose metabolism
mae00520  Amino sugar and nucleotide sugar metabolism
mae01100  Metabolic pathways
mae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Maeo_0377
   00052 Galactose metabolism
    Maeo_0377
   00500 Starch and sucrose metabolism
    Maeo_0377
   00520 Amino sugar and nucleotide sugar metabolism
    Maeo_0377
Enzymes [BR:mae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Maeo_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABR55964
UniProt: A6UTZ2
Position
390082..390939
Genome map
AA seq 285 aa AA seqDB search
MEKMIKKAVIPAAGFGTRLLPLTKAKPKEMLSVVDKPIIQYVIEDLADASVDNILIVTGK
GKSAIENHFDRNYGLENKLKEGGKTELLNIIGKIDNLANIFYTRQKQQKGLGDAIYCGKE
FVGKEYFLALVGDTIYTGNVVQKMLEVYEKYRCSVIVLERVPKELVYKYGVISGKEIEEG
IFELDDLVEKPSVEGAPSNLIITGAYLLSPKIFDHLETIEIGAGGELQLTDAMKSLLKEE
KIMGVEVDCTRYDIGDIEGWLKANVEIAMEKIPNFKDYLKEVVNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgataaaaaaagcagttataccggcggcgggatttggaacaagattattg
cccctaacaaaggcaaaaccaaaagagatgttatcagtagtggataaacccataattcaa
tatgtaattgaagatttggctgatgcaagcgttgataatatattaatagttacaggaaag
ggaaaaagtgcaatagaaaatcattttgatagaaattatgggcttgaaaataaattaaaa
gaaggcgggaaaacagaattattaaatattattggtaaaatagataatttggcaaatata
ttttataccagacaaaaacaacaaaaaggactgggggatgccatatactgcggaaaagaa
tttgtcggaaaagaatattttttagcacttgttggagatacaatatatactggcaatgta
gttcaaaaaatgcttgaagtgtatgaaaaatacagatgttccgtaattgttcttgaaaga
gtgccaaaagaattagtttataaatatggggtaatttctggaaaagaaattgaggaggga
atatttgaattagatgatttagttgaaaaaccatctgttgagggagctccctcaaattta
ataatcacgggggcatatttattatcgccaaaaatatttgaccatttggaaaccattgaa
attggtgctggaggggagctccaattaaccgatgcaatgaaatcattattaaaagaggaa
aaaataatgggtgttgaggtggattgcacccgatatgatataggagatattgagggatgg
ttaaaggcaaatgttgaaattgccatggaaaaaattcccaattttaaggattatttaaaa
gaagttgttaataaataa

DBGET integrated database retrieval system