KEGG   Methanococcus aeolicus: Maeo_0464Help
Entry
Maeo_0464         CDS       T00552                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae00020  Citrate cycle (TCA cycle)
mae00620  Pyruvate metabolism
mae00633  Nitrotoluene degradation
mae00640  Propanoate metabolism
mae00650  Butanoate metabolism
mae00680  Methane metabolism
mae00720  Carbon fixation pathways in prokaryotes
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01200  Carbon metabolism
Module
mae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mae_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0464
   00020 Citrate cycle (TCA cycle)
    Maeo_0464
   00620 Pyruvate metabolism
    Maeo_0464
   00640 Propanoate metabolism
    Maeo_0464
   00650 Butanoate metabolism
    Maeo_0464
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_0464
   00680 Methane metabolism
    Maeo_0464
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Maeo_0464
Enzymes [BR:mae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Maeo_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C OxoGdeHyase_C
Motif
Other DBs
NCBI-ProteinID: ABR56050
UniProt: A6UU78
Position
484721..485872
Genome map
AA seq 383 aa AA seqDB search
MQGMTGHMAVATAVKNSSVDVVAAYPITPQSEIVEIIAKFIADGEMDCEYIPVESEHSAL
SAVIGASACGVRTFTASCGPGVALFHELIPCASGLRLPIVTAITNRSYSAPISIWSDHID
ALAQRDSGAIQMFCESNQEAHDSTIMAYKICENKNVLLPAMVSLDGFILSHTVEPVNPLD
NETIKSFLPELDLEYRLDSENPYTIGPVGGPNIYMELKYQQEKAMNNAMGTIRKTFKEFE
EITGRKYDLIEEYRTEDAETVILTIGAITTTARLIVDELRKEGEKVGLIKLKVFRPFPKE
ELKKILSRFEKIGVIDKNIGFGSGGIVAHEVKSCLYDLDNKPIIKNFIVGLGGRDVTYDN
FRTIFKLLGDNNSKEITWVGVNL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaatgaccggacatatggcagttgccactgcggtgaaaaattcaagtgtcgat
gtggtggcagcatatccaattactccccaaagtgaaattgttgagataatagcaaaattt
attgccgacggtgagatggattgcgagtatattccagtagaatccgaacacagtgcattg
agtgcagtaattggggctagtgcctgcggtgttagaacgtttaccgcatcttgcggacct
ggtgtagcattatttcacgagctcatcccatgtgcttcggggcttaggttgcccattgtt
acggcaattacaaacaggtcttattctgctccaatatcaatatggtcagaccatattgat
gccttagctcaaagagacagtggggcaattcagatgttttgtgaaagtaatcaggaggcc
cacgattctacaataatggcatacaaaatatgcgaaaataaaaatgtgttattgcctgca
atggtatctcttgatggatttatattgtcccatactgttgaacccgtaaatccattagat
aatgaaacaattaaaagttttctcccagaattagatttagaatataggttagactctgaa
aatccttacacaataggaccagttgggggcccaaatatatacatggaattaaaataccaa
caggaaaaggccatgaataatgccatgggcactataagaaaaacatttaaagaatttgaa
gagattactggaaggaaatatgatttaattgaagaatatcgaacagaagatgcagaaact
gttattttaacgattggggcaataactaccactgcacgattaattgtggatgagctaaga
aaagagggggaaaaagtggggttgattaaattaaaagtatttaggccatttccaaaagag
gaattgaaaaaaatactttcaaggtttgaaaaaataggggtaattgataaaaatataggc
tttggttcgggtggaattgtggcccatgaagttaaatcctgcctttatgatttagataat
aaaccaatcataaaaaactttattgttggacttggcggtagagatgtaacttatgacaat
tttagaaccatatttaagttattaggggacaataattcaaaagaaattacttgggtgggt
gttaatctatga

DBGET integrated database retrieval system