KEGG   Methanococcus aeolicus: Maeo_0476Help
Entry
Maeo_0476         CDS       T00552                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mae  Methanococcus aeolicus
Pathway
mae00680  Methane metabolism
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01200  Carbon metabolism
Module
mae_M00567  Methanogenesis, CO2 => methane
mae_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Maeo_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 HTH_3 Fer4_7 Fer4_9 Fer4_6 HTH_31 Fer4_16 HTH_38 HTH_40 HTH_23 Fer4_21 Fer4_10 Fer4_2 HTH_19 Fer4_4 Sigma70_r4_2 RepB HTH_29 HTH_11 HTH_37 Pex14_N Fer4_18 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABR56062
UniProt: A6UU90
Position
complement(499393..499875)
Genome map
AA seq 160 aa AA seqDB search
MTQHILAGLRALTAKKLREKGLTHEEIAKLLNVDRTVITHYLAGRIPAKEAVKCAKVTAE
KFYPRDAVLFIKTVCDDNDIVTTITETLISDNIDVDVAISSKCNLCKICIDICPTKAITI
ENDLINIDKNKCCGCELCQELCQKNAIFLKIIKDNRGELD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacatatattggcaggtttaagggcactcacggcaaaaaaacttcgggaaaaa
ggtttaacacatgaagagattgcaaaattacttaatgtagataggactgtaattacccat
tatttggctggacggatacctgcaaaagaagctgttaaatgtgcaaaagtcacggccgaa
aaattttatccgcgagatgctgttctttttattaaaaccgtatgtgatgacaatgacatt
gtaactacaattacggaaacattaatttctgataatattgatgttgatgtagccatttcc
agtaaatgtaatttatgtaaaatatgtattgacatatgtccaacaaaggcaataactatt
gaaaacgatctaatcaatattgataaaaataaatgttgtggatgtgagttatgtcaagaa
ttatgccaaaaaaatgcaatatttttaaaaataattaaggataatagaggagagttagat
taa

DBGET integrated database retrieval system