KEGG   Methanococcus aeolicus: Maeo_0635Help
Entry
Maeo_0635         CDS       T00552                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mae  Methanococcus aeolicus
Pathway
mae00680  Methane metabolism
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01200  Carbon metabolism
Module
mae_M00567  Methanogenesis, CO2 => methane
mae_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Maeo_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4_9 Fer4_10 HTH_3 Fer4_21 Fer4 Fer4_17 Fer4_7 Fer4_2 HTH_23 HTH_19 Fer4_18 Fer4_15 Fer4_22 HTH_5 Fer4_13 Fer4_3 MarR_2 Fer4_16 Fer4_4 HTH_37
Motif
Other DBs
NCBI-ProteinID: ABR56219
UniProt: A6UUP7
Position
complement(653626..654072)
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAIIAIKLKKEGKLQREIAEYLKIDRSAVSHYVNGRYPSEKVLAVANEIVE
LPIKQGIFIINTLSRDKELTNRIIKNIYGDSTAIEINSDTCILCGGCLECEYDAISINNT
NYLINIDNKSCVLCGKCLKICPEHIDIK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacacattttatcaggtattaaagcaataattgcgataaaactaaaaaaagaa
ggaaaactacaaagagaaatagcagaatatctaaaaatagataggtctgctgtatcccat
tatgtaaatggtagatatccttctgaaaaagttttggccgttgcaaatgaaattgtggag
ctccccattaaacagggcatatttataataaatactcttagtagggataaagaattaaca
aatcgaattataaaaaatatatatggcgatagcacggctattgagataaacagcgataca
tgtattctttgtgggggctgtcttgaatgcgaatatgatgctatttccataaataatact
aattatttaattaacatagacaataagtcatgtgttttatgtgggaaatgtttaaaaata
tgtcccgaacatattgatattaaataa

DBGET integrated database retrieval system