KEGG   Methanococcus aeolicus: Maeo_1006Help
Entry
Maeo_1006         CDS       T00552                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00020  Citrate cycle (TCA cycle)
mae00620  Pyruvate metabolism
mae00720  Carbon fixation pathways in prokaryotes
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01200  Carbon metabolism
mae01230  Biosynthesis of amino acids
Module
mae_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maeo_1006
   00620 Pyruvate metabolism
    Maeo_1006
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_1006
Enzymes [BR:mae01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Maeo_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp_3 GARS_A ATP-grasp ATP-grasp_5 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ABR56584
UniProt: A6UVR2
Position
1031751..1033280
Genome map
AA seq 509 aa AA seqDB search
MFKKILIANRGEIAVRIIRACQELDIKTVAIYSEADENALYTSIADECYCIGPPQASKSY
LNLDMIVHVAKKTGAEAIHPGYGFLSENLEFAKACENNGIVFIGPPSEAIDAMGSKINAK
KIMKNANVPVLPGREEPIEDPEEVVEIAEEIGYPVIIKASAGGGGMGMAVAYNKQELKEV
VESTKSIAQSAFGDSTVFIEKYLENPRHIEIQVLGDKYGNVVHLGDRECSIQRRHQKLIE
EAPSPIMTEELRKKMGDAAISAAKAINYYSAGTVEFLYDNGEFYFLEMNTRVQVEHPITE
IITGVDIVKEQIKIAYGEKLPFKQEDIVIRGHAMECRINAEDPVNDFVPTPGVIKHYRSP
GGPGIRIDSGVYAGAEIPPYYDSLISKFISYGNDRDEAIARMKRALSEYIIIGLTTNIPF
HRAVMDELDFKNGNISTHYIEEHSEYLKENIMKYAIEAKDEEKLYADKIFGKNKQVVAIA
GGLNAYISSVVASNKNIDKCDEKYSEEQN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaatattaatcgccaacagaggagaaattgctgttagaattattagagca
tgtcaggaattagacataaaaaccgtagcaatttattctgaagccgatgaaaatgcatta
tatacttcaatagccgatgaatgttattgtatcggccctccacaagcttcaaaaagttat
cttaatcttgatatgatagtccatgtagcaaagaaaacaggtgcagaagcaattcaccca
ggatatggttttttatctgaaaatttggaatttgccaaagcatgtgagaataatggaata
gtatttattggacctccgtcggaagccatagatgccatgggtagcaaaataaatgctaaa
aaaataatgaaaaatgccaatgttccagttctccctggaagggaagaaccaattgaagac
cccgaagaggttgttgaaattgcagaagaaattggctaccctgtaattattaaagcctcc
gcaggtggtggaggtatgggaatggccgtggcatacaataaacaagaattaaaagaagtg
gtagagtccacaaagtcaatagctcaaagtgcatttggggattccactgtatttattgaa
aaatatttggaaaacccaagacatattgaaatccaagtattgggagataaatacggaaat
gtagttcatttgggagatagggagtgttccattcagagaagacatcaaaaacttattgaa
gaagctccatctccaataatgacagaagaattaagaaaaaaaatgggggatgctgcaatt
tcagcagcaaaagctataaactattatagtgccggaactgtggaattcttatacgataat
ggagaattttattttttggaaatgaatacaagagttcaagttgaacatccaattacagaa
attatcacaggagtagatattgtaaaggaacaaataaaaatagcatatggggaaaaatta
ccgttcaaacaagaggacattgtaattagaggacatgctatggaatgcagaataaatgca
gaagaccccgtaaatgattttgttcctactcccggggtaattaaacattataggtcccca
ggaggcccgggaattagaatagatagtggcgtctatgccggtgcagaaattcctccatat
tatgattcattaatatctaaattcatatcctatggaaatgatagagatgaagcaatagca
agaatgaaaagagcattatccgaatatattattatcggacttaccacaaatataccattc
catagggcagttatggacgaattagactttaaaaatggaaatatatccacccattatatt
gaagaacattcagaatatttaaaagaaaatataatgaaatatgccattgaagctaaggac
gaagaaaaattatatgccgataaaatatttggaaaaaacaaacaagttgtagcaattgca
ggtggattaaatgcatatatttcaagtgttgtagcttcaaataaaaatatagataaatgc
gatgaaaaatattcagaagagcaaaattaa

DBGET integrated database retrieval system