KEGG   Methanococcus aeolicus: Maeo_1056
Entry
Maeo_1056         CDS       T00552                                 

Name
(GenBank) major facilitator superfamily MFS_1
Organism
mae  Methanococcus aeolicus
SSDB
Motif
Pfam: MFS_1 MFS_1_like MFS_3
Other DBs
NCBI-ProteinID: ABR56634
UniProt: A6UVW2
Position
1090829..1092019
AA seq 396 aa
MNNPKKPKKEYFGIDKDVLLLTTVSFINDLSSEMIMPILPLFITSLGGSSVVVGLIGGLK
DSISSILKVISGYYSDKTGRRKVFVFAGYLTSSIFKLLLSFSTTWFGVLFFSAFERVGKG
VRTAPRDAIISDLMAEKRGMGFGIQRAGDTFGAILGSVGVLILFWYLYYDFREIILISAS
LSFLALVPLYFLKEKKKIKRQNLSLKIGLKNLSTPLKLFILISGIFTLANFSYMFYILKA
QTIFTGRLAIGAPIILYILFNIFYGIFALPFGVLSDKIGRKKVIIFGYLIYAITAFGFAL
FNSLNYFIILFALYGISYAIIEGNQRAYVSDLSSEYIRGTALGTFHTIVGLMALPSSLIA
GYLWSIDPNIPFIYGGIVALISSMLFIIFAIKFKLS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaacaaccccaaaaaacccaaaaaagaatattttggaattgataaagatgttttatta
cttaccacagttagttttataaatgatttaagtagtgaaatgattatgccaattcttcca
ttatttataacttcattggggggttcaagtgtagttgttggtctaatagggggattaaaa
gatagtatatcaagtattttaaaggtaatatctggatattattctgataaaacaggcagg
agaaaagtttttgtttttgcaggttatttaacctcatccatttttaaattattactttca
ttttcaactacttggtttggagttttatttttttcggcatttgaaagggttggaaaaggt
gtaagaacagccccacgagatgccattatatcagatttaatggccgaaaaaagaggaatg
ggatttggaattcaacgggcaggagatacatttggggcaatacttgggtctgtgggcgta
ctcatacttttctggtacttatattatgattttagggaaattatattaatatcggcgtcc
ctttcatttttagcactggttcctctttattttcttaaagagaaaaaaaagattaaaagg
caaaatttatcgctaaaaataggtttaaaaaatttatcaactccattaaaactatttata
ttgatatctggtatatttacattggccaattttagttatatgttttatatcctaaaagcc
cagacaatttttactggtcggttggctatcggagctcccataatattatatattttgttt
aatatattttatggcatatttgctcttccttttggagttctttcggataaaatagggaga
aaaaaagttattatttttggatacctcatatatgccataactgcctttggatttgcatta
tttaattctttaaattatttcataatattatttgcactatatggaatatcctatgccata
attgaaggaaaccagagagcttatgtatccgatttatcatcagaatatataaggggaact
gcattgggaacatttcataccattgttggtttaatggcattgccttcaagtttaatagct
gggtatttatggagtatcgaccccaacataccttttatatatgggggaattgtggcatta
atttcaagcatgttatttataatatttgcaataaagtttaagttaagttaa

DBGET integrated database retrieval system