KEGG   Mariprofundus aestuarium: Ga0123461_0273Help
Entry
Ga0123461_0273    CDS       T05212                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
maes  Mariprofundus aestuarium
Pathway
maes00860  Porphyrin and chlorophyll metabolism
maes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maes00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ga0123461_0273
Enzymes [BR:maes01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Ga0123461_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ATX78725
UniProt: A0A2K8KV90
Position
complement(260075..260686)
Genome map
AA seq 203 aa AA seqDB search
MAEAAIIDLLRHGEVEGAVSVARGCRTDVPLTESGWSQMDAVAQSLHLEGSLTAIATSPV
SRCALFAGQFSTQAGLPLTVLEQMREIDFGHWEGKQAHEIQEQELLTRFMENPDGVQLPG
GESFNMFARRIIEEWESWIHGASGEHRLLISHGLVKRVLLSHLLAIPLSHIWRLALPYGA
WSRVSLMQGEQPRLLFLNREVKP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcggccatcatcgatctgctgcgccacggcgaggtagaaggcgctgtatca
gttgctcgcggctgtcgcaccgatgtgccactgacagagagtggctggtcacaaatggat
gccgttgctcaatccctgcatctagaaggatcactaacagccatcgccacatcaccggta
tcccgctgcgccctttttgcagggcagttcagcacccaggcgggcctcccgcttacggtt
ctggagcagatgcgcgaaatcgacttcggccactgggagggcaaacaggcccatgaaatc
caggagcaggagctattgacccgttttatggagaatcccgatggggtgcagcttcccggt
ggcgaatctttcaatatgtttgcccggcgaattattgaagagtgggaatcatggattcat
ggcgcatcgggtgaacaccgactgctgatcagccacgggctggtcaagcgggtcctgctc
tcgcacctgctggccatccctctctcgcatatctggcgtctcgctcttccctatggcgca
tggagcagggtttctctcatgcagggtgaacagccccggcttctatttctcaaccgcgag
gttaaaccctaa

DBGET integrated database retrieval system