KEGG   Mariprofundus aestuarium: Ga0123461_1416Help
Entry
Ga0123461_1416    CDS       T05212                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
maes  Mariprofundus aestuarium
Pathway
maes00564  Glycerophospholipid metabolism
maes01100  Metabolic pathways
maes01110  Biosynthesis of secondary metabolites
Module
maes_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:maes00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ga0123461_1416
Enzymes [BR:maes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Ga0123461_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ATX79830
UniProt: A0A2K8KXW8
Position
complement(1424704..1425450)
Genome map
AA seq 248 aa AA seqDB search
MKLECHTLLGYGQRCRYPVAMTKELLMSGEPSGTIPFAPEGWRFIVPTAVLMFITWALGW
GLSSTVLFVLLLFLLNFFRDPARAVPQGDDLFVSPADGKVIRAEMTDQGHQRVDIFMNVF
NVHVNRAPMAGRITHMQYFPGKFVNASFDHATEENERNRFEMACDDGVNIAFTQISGLVA
RRIVSYVEVGDRVEAGQRIGMIRFGSRVNCEIPAGYELSVKVGEMVTAGLTVVARKTKEK
GGEINADA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaatgtcatacattgcttgggtatggtcagcgttgccgctaccctgtcgcc
atgactaaagaactcctgatgtccggagagcctagtggcaccattccattcgccccagaa
gggtggcgttttattgttccgactgcagttctgatgttcatcacctgggcacttggttgg
gggctatcctcaacggtgctgtttgtactgcttctgtttctgctgaactttttcagggat
ccagcgcgagccgtgccacagggggatgacctgtttgtctctcctgccgatggtaaggtg
attcgtgctgagatgaccgatcaggggcatcagcgtgttgatatctttatgaatgtattc
aatgtgcatgtaaaccgggcacccatggccggccgcattacgcatatgcagtactttccg
ggaaagttcgtaaatgctagttttgatcacgccactgaggaaaatgaacggaaccgtttc
gaaatggcgtgcgatgatggagtcaatatcgctttcacccagatttcaggtctggtagcg
cgtcgtatcgtctcctatgtcgaggtaggtgaccgtgtcgaggcaggccagcgcatcggt
atgatccgatttggttcacgtgtaaactgcgagattcctgccggctatgagctgagtgtg
aaagtaggtgaaatggttacagctgggttgactgtggttgcacgcaagacgaaagagaag
ggtggagaaatcaatgccgatgcttaa

DBGET integrated database retrieval system