KEGG   Mariprofundus aestuarium: Ga0123461_2001Help
Entry
Ga0123461_2001    CDS       T05212                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
maes  Mariprofundus aestuarium
Pathway
maes00030  Pentose phosphate pathway
maes00480  Glutathione metabolism
maes01100  Metabolic pathways
maes01110  Biosynthesis of secondary metabolites
maes01120  Microbial metabolism in diverse environments
maes01130  Biosynthesis of antibiotics
maes01200  Carbon metabolism
Module
maes_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
maes_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:maes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ga0123461_2001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ga0123461_2001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maes04147]
    Ga0123461_2001
Enzymes [BR:maes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Ga0123461_2001
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Ga0123461_2001
Exosome [BR:maes04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Ga0123461_2001
  Exosomal proteins of colorectal cancer cells
   Ga0123461_2001
  Exosomal proteins of bladder cancer cells
   Ga0123461_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ATX80407
UniProt: A0A2K8KZI8
Position
2042336..2043856
Genome map
AA seq 506 aa AA seqDB search
MNSTSVPQPEPCNIVIFGASGDLTKRKLLPALARMHHWNLIAPNSRITGIVRNHEWDIDH
WRSYVHDALQQFRPDCLSDTAAWQSISDMLALTVGDLSDAQTYTRLQETLISADGKTNVL
FYLAIPPEWYERVASNLNAAGLLNESSGFRRIVIEKPFGSDLASARELNRTLREHMKERQ
IYRIDHYLGKEGVQNLMVFRFANTVFEPLWNRNYIDHVQISVSESLGVEYRAGYYEKAGA
LIDMIQSHLIQVMTLVAMESPVSLDGDAVRDEKVKVLKAVRPIPADRVSEFAVRAQYAGG
TVEGKRIPAYRDEPGVDPDSTIETFAAIKLYIDNWRWQDVPFLLRTGKRLPNRVSEIAIR
FKRPPMNLFSESSSQLPQNELIFRLHPDEGMVYLLNAKLPGLNDQLRELALDAPYAVAGA
DSPEAYETLLHDALLGQNALFSRADEVEESWRIVTPVMDAWKQKQSIRFYEAGSWDIPEI
ETMMQGCVGCWRDLSEHHQHGYSKST
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacgtcagttccgcaacctgaaccctgtaacattgtcatcttcggtgcttcc
ggagacctgaccaaacgcaaactgctgcctgcactggcacgcatgcaccactggaacctg
attgccccgaactcacgcatcacaggtattgtgcgtaatcatgaatgggatattgatcac
tggcgcagctatgtgcatgacgcactgcagcagtttcgccccgactgcctgagtgatacg
gccgcatggcaatcaatcagcgacatgctggcactgacagttggtgatctctccgatgct
cagacctatacgcggctgcaggaaacattgatcagcgccgatggtaaaaccaatgtcctg
ttctatctggccattcctcctgagtggtatgaacgagttgcctccaacctcaatgcagca
gggctgctgaatgagagcagtggctttcgccgtatcgtcatcgagaaaccattcggcagt
gatctcgcctcggccagagaactcaatcgtaccctgcgcgaacatatgaaggagcggcag
atctaccgtatcgaccactacctcggtaaagagggtgtacagaacctgatggtattccgc
tttgccaataccgtgtttgaaccgctatggaaccgcaactatatcgatcatgtacagata
tccgtatccgagagtctgggggtagagtacagggctggttattatgaaaaagccggcgca
ctgattgatatgattcagagccacctgattcaggtgatgacactggtagccatggagtca
ccggtctcccttgatggtgatgccgtgcgtgatgaaaaggtaaaggtgctcaaagctgta
cgtccgattccggctgaccgggtcagtgaatttgccgttcgtgcccagtacgctggtggt
acagttgaaggcaaacgcattccggcctaccgcgatgaacccggagttgatccggactcc
acgattgaaacctttgccgctatcaaactctatatcgataactggcgctggcaggatgta
ccgttcctgctacgtaccggcaagcgactgcccaatcgtgtctctgaaatcgctatccgt
tttaaacggccaccgatgaatcttttctccgagagtagtagccaactgccgcaaaatgag
ctgatcttccgcctgcatcccgacgagggaatggtctacctgctcaatgccaaattgccg
ggattgaacgaccagctgcgtgagctggcactggatgcgccctatgccgtggcaggcgcg
gactctccggaggcctatgagacactgcttcacgatgccctgctcggccagaacgcgctc
ttctcccgcgccgatgaagttgaggagtcatggcgcatcgtcaccccagtgatggatgcc
tggaagcagaaacagagcatccgattctatgaggcgggcagttgggatatccctgaaatt
gaaaccatgatgcaggggtgtgtgggctgctggcgtgacctctcggagcatcaccagcat
ggatattcgaaaagcacctga

DBGET integrated database retrieval system