KEGG   Mycobacterium africanum: MAF_16110Help
Entry
MAF_16110         CDS       T01575                                 

Gene name
hisD
Definition
(GenBank) putative histidinol dehydrogenase HisD (HDH)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
maf  Mycobacterium africanum
Pathway
maf00340  Histidine metabolism
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01230  Biosynthesis of amino acids
Module
maf_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MAF_16110 (hisD)
Enzymes [BR:maf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MAF_16110 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CCC26683
UniProt: F8M864
Position
1796122..1797438
Genome map
AA seq 438 aa AA seqDB search
MLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccgtatcgacttgcggggagccgagttgacagctgccgagctgcgggccgct
ctgccacgcggcggcgccgatgtggaagccgtgctgccgacggtacggcccattgtggcg
gccgtcgccgagcgcggggccgaggccgcgctggacttcggcgcatcgttcgacggtgtg
cggccccatgccatccgggtgccagacgcagcgctggacgcggcgctggccggactggac
tgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacccgcgccgtgcactccggg
cagcgtcgcaccgacgtcacaaccacactgggcccgggcgcgacggtcaccgagcggtgg
gttccggtcgagcgggtaggcctgtacgtgccggggggcaatgcggtgtacccatccagc
gtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgactcgttggtggtagccagc
ccgccgcaggcgcagtgggatggaatgccgcatccgaccattctggccgcggcccggctg
ctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcggtggcgttgctggcttac
ggcggcaccgacaccgacggcgcagcactgacaccggtcgacatgatcaccgggcctggc
aacatctatgtcacggccgccaagcgactgtgccgttcgcgggtgggcatcgacgccgaa
gcggggccaaccgagatcgctatcctcgccgatcacaccgccgacccggtgcatgtggcc
gccgacctgattagccaggccgaacacgacgagttggctgccagcgtgctggtcactccg
agtgaggacctggccgatgccaccgacgccgaactggctggccagctgcagactacggtg
caccgcgaacgggtgacggccgcgctgaccggacgccaatcggcgatcgtcctggtcgac
gacgtggacgccgccgtcttggtggtgaacgcttacgccgctgagcatttggagattcag
accgccgatgccccgcaggttgccagccggatccgctcggcgggagccattttcgtcggc
ccgtggtccccggtgagcctcggcgactactgcgcgggatccaaccatgtactgccgacc
gcgggctgcgcccggcattccagcggcctgtcggtgcagacgttcctgcgcggcatccac
gtcgtggaatacacggaggcggccctcaaagacgtttccggacacgtgatcacgctcgcc
acggccgaggacttgccggcgcacggtgaggcggtacggcggaggttcgagcgatga

DBGET integrated database retrieval system